Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_089136363.1 CES79_RS03835 methionine ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_002217945.1:WP_089136363.1 Length = 345 Score = 129 bits (325), Expect = 9e-35 Identities = 71/220 (32%), Positives = 128/220 (58%), Gaps = 5/220 (2%) Query: 22 LNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIKDRNVTW--EEPKDR---G 76 +++ +D GE ++G SG GKSTL+ I GL ++G + + ++++T +EP + Sbjct: 34 VSISVDRGEIFGVIGYSGAGKSTLIRMINGLETPTEGSVKVDNQDITQLKKEPLAQLRHK 93 Query: 77 IGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQIQPLLKRKPSELSG 136 IGM+FQ+Y L T+ +N++ LK+ KIP EI++R ++ +I+ + PS+LSG Sbjct: 94 IGMIFQNYNLLKTATIYQNITIPLKLEKIPKDEIQQRAEKYLKIVGLWDRRNSYPSQLSG 153 Query: 137 GQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQSLKNTMIYVTHDQIE 196 GQ QRVA+ RAL + + L DE S LD + S + +K ++Q L T+ +TH+ Sbjct: 154 GQSQRVAVARALAHEPTILLSDEATSALDPETTSSILDLLKDINQKLGLTIFIITHELDV 213 Query: 197 ALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGS 236 ++ D++A+M++G + + + ++ P+ F+GS Sbjct: 214 VKSICDKVAIMEAGNVVEQGRTIDVFTGPKQEVTRQFLGS 253 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 345 Length adjustment: 29 Effective length of query: 332 Effective length of database: 316 Effective search space: 104912 Effective search space used: 104912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory