Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate WP_054653757.1 CES79_RS00820 amino acid ABC transporter permease
Query= TCDB::P48245 (273 letters) >NCBI__GCF_002217945.1:WP_054653757.1 Length = 217 Score = 120 bits (300), Expect = 3e-32 Identities = 66/216 (30%), Positives = 128/216 (59%), Gaps = 6/216 (2%) Query: 16 FINSQTWTT--YILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETF 73 F+++ +W Y+L GLW T+ +V S+I + ++G+ LG+ R I+++ + I+ Sbjct: 4 FLDAYSWINIHYLLQGLWITVAVSVVSIIGSYILGSILGIIRYVNIKVVSPVIGLFIDII 63 Query: 74 RAIPVLILMIFAYQMFAQYNIVPSSQLAFAAVVFGLTMYNGSVIAEILRSGIASLPKGQK 133 R +P+L+++ F Y PSS A +F +T++ ++IAEI+RSGI ++ GQ Sbjct: 64 RNLPLLLIIFFTYFGLPNLGFRPSSVWA---TIFAMTIFESTMIAEIVRSGIVAVDPGQM 120 Query: 134 EAAIALGMSSRQTTWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSA 193 E A A G++ Q + I+LPQA+ M+PAL+SQ + +KD++L I +++ + Sbjct: 121 EGARANGLTYGQALYHIILPQAMKKMIPALVSQFISLIKDTSLATIIVLPDLMHNAQIVY 180 Query: 194 SVNRNYLAALF-VVALIMIVLNFSLTALASRIERQL 228 N Y+ +F ++A++ ++ ++L+ L+ +ER++ Sbjct: 181 GQNSTYILPMFLMIAIMYFIVCYALSVLSRSLERRM 216 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 217 Length adjustment: 23 Effective length of query: 250 Effective length of database: 194 Effective search space: 48500 Effective search space used: 48500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory