Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_089137055.1 CES79_RS09755 ABC transporter substrate-binding protein/permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_002217945.1:WP_089137055.1 Length = 496 Score = 151 bits (381), Expect = 2e-41 Identities = 79/201 (39%), Positives = 134/201 (66%), Gaps = 6/201 (2%) Query: 18 GALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQLFILFF 77 G T+ I+A S++ G ++G ++ + R + K ++++A+ AYV +RGTPL+VQ+ ++F Sbjct: 297 GIEYTLIISAISVIFGVLLGTILALMRFS-KSKLLHAISIAYVEFVRGTPLMVQVMFVYF 355 Query: 78 GLPQFGIL--LPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIGMSSGLAMR 135 G+ GI+ LPA + G+I + + SGAYV E++RG I S+DKGQ EA+ S+G++ MR Sbjct: 356 GI---GIVVNLPALLSGIIAVSLNSGAYVEEIIRGGINSVDKGQTEASASLGLAKTDTMR 412 Query: 136 TVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSLEVYLAIAV 195 VVLPQA+ + P LGNEF++LIK S++VS++ + DL+++ + + +YR + + Sbjct: 413 FVVLPQALKNIWPALGNEFVSLIKESSIVSIIGVTDLIYQLNIVRADTYRGVMPVFVAMI 472 Query: 196 VYFILTGATTLVLRRIELRLR 216 +YF++T T VL E R++ Sbjct: 473 IYFVMTFILTRVLNYFEGRMK 493 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 496 Length adjustment: 28 Effective length of query: 194 Effective length of database: 468 Effective search space: 90792 Effective search space used: 90792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory