Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized)
to candidate WP_054653756.1 CES79_RS00815 amino acid ABC transporter permease
Query= reanno::Smeli:SMc02120 (384 letters) >NCBI__GCF_002217945.1:WP_054653756.1 Length = 212 Score = 123 bits (309), Expect = 4e-33 Identities = 65/205 (31%), Positives = 121/205 (59%), Gaps = 8/205 (3%) Query: 175 GLMVTLVLSFVGIAVSLPLGILLALGRRSNMPVIKMLCTVFIEVIRGVPLITVLFMASVM 234 G TL+ S + + SL +G + A+ + + ++++ ++IEV R +PL+ + V+ Sbjct: 15 GFGQTLLCSVIALVFSLIIGSMFAIFETTPIKALRVIARIYIEVFRNIPLLVITMFFFVV 74 Query: 235 LPLFLPQGVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMG 294 +P+F+ + + F IG++++ SA++AE VR G+Q++ GQ EGA + GLSFWQ M Sbjct: 75 IPMFITK---INGFTAGTIGLTIYTSAFIAETVRSGIQSVDPGQMEGARANGLSFWQAMR 131 Query: 295 FIVLPQALKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWATAVTPLTGL 354 +IVLPQA + VIP + N FI L K++S+++ + FDL+ + SD ++ ++ Sbjct: 132 YIVLPQAFRYVIPPLGNQFINLVKNSSVLAFVAGFDLMYQGNVIASD-----SLNTMSTY 186 Query: 355 IFAGFVFWLFCFGMSRYSGFMERLL 379 I G ++ + +S + ++E+ L Sbjct: 187 ICIGILYLIITLPLSYWMRYLEKKL 211 Lambda K H 0.329 0.144 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 212 Length adjustment: 26 Effective length of query: 358 Effective length of database: 186 Effective search space: 66588 Effective search space used: 66588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory