Align Histidine transport system permease protein HisM (characterized)
to candidate WP_089136315.1 CES79_RS03445 ABC transporter permease subunit
Query= SwissProt::P0A2I7 (235 letters) >NCBI__GCF_002217945.1:WP_089136315.1 Length = 479 Score = 94.7 bits (234), Expect = 3e-24 Identities = 65/211 (30%), Positives = 100/211 (47%), Gaps = 9/211 (4%) Query: 17 GYRFTGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLL 76 G G T+WL + ++ L VI+ + V NKF YIFRG PL V L Sbjct: 275 GALLNGFEQTVWLTVVAIFFATLFGVIVGLLGVVPNKFFNGLSTTLIYIFRGLPLLVLAL 334 Query: 77 VFYSGMYTLEIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAA 136 Y+G+ +L K + AF + L N AY G I +V G++EAA Sbjct: 335 FIYTGIPSLTGSK----IPAFVAG-----TITLMFNEGAYIAAFVKGGINAVDDGQMEAA 385 Query: 137 RAYGFSSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSAT 196 R+ G K R IILP +RI +P++ N+ I+ L T++ + +L + + I + Sbjct: 386 RSLGLPFGKSMRRIILPQGIRIMIPSFINQFIITLKDTSILSIIGIIELTQTGKIIIARN 445 Query: 197 YQPFTAFGIAAVLYLLISYVLISLFRRAERR 227 + F + I A++YL++ +L L ERR Sbjct: 446 LEGFKVWTIIAIIYLIVITLLTWLSNWVERR 476 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 479 Length adjustment: 28 Effective length of query: 207 Effective length of database: 451 Effective search space: 93357 Effective search space used: 93357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory