Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate WP_089136315.1 CES79_RS03445 ABC transporter permease subunit
Query= reanno::pseudo6_N2E2:Pf6N2E2_2959 (242 letters) >NCBI__GCF_002217945.1:WP_089136315.1 Length = 479 Score = 102 bits (253), Expect = 2e-26 Identities = 71/211 (33%), Positives = 109/211 (51%), Gaps = 20/211 (9%) Query: 25 QGTWMTIKLSALSLLLSVLLGLLGASAKLSSVKLLRIPAQLYTTLI---RGVPDLVLMLL 81 Q W+T+ + L V++GLLG + L TTLI RG+P LVL L Sbjct: 283 QTVWLTVVAIFFATLFGVIVGLLGVVPN-------KFFNGLSTTLIYIFRGLPLLVLALF 335 Query: 82 IFYSLQTWLTSLTDFMEWEYIEIDPFGAGVITLGFIYGAYFTETFRGAILSVPRGQVEAA 141 I+ T + SLT +I F AG ITL F GAY +G I +V GQ+EAA Sbjct: 336 IY----TGIPSLTGS------KIPAFVAGTITLMFNEGAYIAAFVKGGINAVDDGQMEAA 385 Query: 142 TAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSIIGLADLVKAAQDAGKST 201 + GL G+ R ++ PQ +R +P N +++ LK T+++SIIG+ +L + + Sbjct: 386 RSLGLPFGKSMRRIILPQGIRIMIPSFINQFIITLKDTSILSIIGIIELTQTGKIIIARN 445 Query: 202 YQLFYFLVLAALIYLLITSASNFILRWLERR 232 + F + A+IYL++ + ++ W+ERR Sbjct: 446 LEGFKVWTIIAIIYLIVITLLTWLSNWVERR 476 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 479 Length adjustment: 28 Effective length of query: 214 Effective length of database: 451 Effective search space: 96514 Effective search space used: 96514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory