Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_089136363.1 CES79_RS03835 methionine ABC transporter ATP-binding protein
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_002217945.1:WP_089136363.1 Length = 345 Score = 140 bits (354), Expect = 4e-38 Identities = 77/244 (31%), Positives = 128/244 (52%), Gaps = 11/244 (4%) Query: 4 VTLRDICKSYDGTPITRHI------DLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITS 57 + + + K++ GT T+ + + ++ GE +G SG GKSTL+R+I GLE T Sbjct: 10 IEFKHVSKTFKGTATTKEVHAVHDVSISVDRGEIFGVIGYSGAGKSTLIRMINGLETPTE 69 Query: 58 GDLLIDNQRVNDLPPKD-----RSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKR 112 G + +DNQ + L + +GM+FQ+Y L T+ +N+ LKL + K EI++ Sbjct: 70 GSVKVDNQDITQLKKEPLAQLRHKIGMIFQNYNLLKTATIYQNITIPLKLEKIPKDEIQQ 129 Query: 113 RVEAVAEILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQM 172 R E +I+ L P LSGGQ QRVA+ R + EP + L DE S LD + Sbjct: 130 RAEKYLKIVGLWDRRNSYPSQLSGGQSQRVAVARALAHEPTILLSDEATSALDPETTSSI 189 Query: 173 RIEIARLHQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAG 232 + ++Q++ T+ +TH+ ++ DK+ ++ AG + + G+ + ++ PK Sbjct: 190 LDLLKDINQKLGLTIFIITHELDVVKSICDKVAIMEAGNVVEQGRTIDVFTGPKQEVTRQ 249 Query: 233 FLGS 236 FLGS Sbjct: 250 FLGS 253 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 345 Length adjustment: 29 Effective length of query: 342 Effective length of database: 316 Effective search space: 108072 Effective search space used: 108072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory