Align glucose transporter, ATPase component (characterized)
to candidate WP_089136363.1 CES79_RS03835 methionine ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_002217945.1:WP_089136363.1 Length = 345 Score = 111 bits (278), Expect = 2e-29 Identities = 75/238 (31%), Positives = 127/238 (53%), Gaps = 21/238 (8%) Query: 14 PLVEMKDISISFGG------IKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQM 67 PL+E K +S +F G + AV VS+ + GE+ G++G++GAGKSTLI++++G Sbjct: 8 PLIEFKHVSKTFKGTATTKEVHAVHDVSISVDRGEIFGVIGYSGAGKSTLIRMINGLETP 67 Query: 68 DAGEIRVNGDKVEIT----NPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTPFGL 123 G ++V D +IT P H I I+Q L N+ + +L Sbjct: 68 TEGSVKV--DNQDITQLKKEPLAQLRHKIGMIFQNYNLLKTATIYQNITIPLKLEK---- 121 Query: 124 VDDSAMEAECRKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAA 183 + ++ K + + ++ S P S LSGGQ Q VA+ARA+ IL+ DE T+A Sbjct: 122 IPKDEIQQRAEKYLKIVGLWDRRNSYP-SQLSGGQSQRVAVARALAHEPTILLSDEATSA 180 Query: 184 LGPHETQMVAELIQQLKAQ-GIGIFLIDHDVNAVMELCDRASVMKNGQLV---GTVDI 237 L P T + +L++ + + G+ IF+I H+++ V +CD+ ++M+ G +V T+D+ Sbjct: 181 LDPETTSSILDLLKDINQKLGLTIFIITHELDVVKSICDKVAIMEAGNVVEQGRTIDV 238 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 345 Length adjustment: 27 Effective length of query: 233 Effective length of database: 318 Effective search space: 74094 Effective search space used: 74094 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory