Align Aromatic amino acid transporter AroP (characterized, see rationale)
to candidate WP_089137183.1 CES79_RS10735 amino acid permease
Query= uniprot:A0A2Z5MFR8 (461 letters) >NCBI__GCF_002217945.1:WP_089137183.1 Length = 462 Score = 330 bits (845), Expect = 8e-95 Identities = 176/448 (39%), Positives = 276/448 (61%), Gaps = 8/448 (1%) Query: 10 LKRGLKNRHIQLIALGGAIGTGLFLGSASVLQAAGPSMILGYAIGGVIAFMIMRQLGEMV 69 L+R + +++I+LGGAIG GLF+GS S ++ GPS++L Y G+I +++MR LGEM+ Sbjct: 11 LRRSMTAGQMEMISLGGAIGVGLFMGSTSTIKWTGPSVLLAYMFVGLILYIVMRALGEMI 70 Query: 70 AQEPVAGSFSHFAYKYWGDFPGFLSGWNYWVLYVLVSMAELTAVGTYVHYWWPGVPTWVS 129 P GSF+ +A +Y G+L+ W Y++V M+E+ A Y+ YWWP + T+ Sbjct: 71 YVNPGTGSFADYATEYVHPLAGYLAKWANVFEYIVVGMSEVVAATQYLQYWWPHINTFTV 130 Query: 130 ALVCFAGINAINLANVKAYGETEFWFAIIKVVAVIGMILFGGYLLVSG--HGGPQASISN 187 ++ A + A NLA+ KAYG EFWFA+IKV+ +I MI+ G ++ G +GG SN Sbjct: 131 GVIIIAFLVAANLASAKAYGSLEFWFAMIKVITIIMMIILGLLVIFFGLGNGGHPVGFSN 190 Query: 188 LWSHGGFFPHGFHGLFTMLAVIMFSFGGLELIGITAAEADEPQKSIPKAVNQVIYRILIF 247 LWSHGGFF G G F +++I+ S+ G+EL+GITA E PQK+I K+V V++RILIF Sbjct: 191 LWSHGGFFTGGVKGFFFSMSIIVGSYEGIELLGITAGEVANPQKAIVKSVKSVLFRILIF 250 Query: 248 YICSLAVLLSLYPWNEVAAGGSPFVMIFSQIGSTLTANVLNVVVLTAALSVYNSGVYANS 307 Y+ ++ V++++YPWN ++A GSPFV F+++G T A+V+N VVLTAALS NSG+Y++S Sbjct: 251 YVGAIFVIVTIYPWNRLSAIGSPFVSTFAKVGITAAASVINFVVLTAALSSANSGIYSSS 310 Query: 308 RMLYGLAEQGNAPRALMKVDRRGVPYMAIGLSALATFTCVIVNYLIPA--EALGLLMALV 365 RML+ LA + +AP+ ++ +R VP AI + F +++ + A ++ L +V Sbjct: 311 RMLFKLAHESDAPKIFGRLSKRVVPDAAILGISSGIFLGFLLDIIFSAYNKSTSDLFVVV 370 Query: 366 VAALVL----NWALISLTHLKSRRAMVAAGETLVFKSFWFPVSNWICLAFMALILVILAM 421 ++ VL W +I L L+ R+ + FK +P SN+ + + +I+ + + Sbjct: 371 FSSSVLPGMIPWFVILLAELRFRKNNAIVMKDHPFKLPLYPFSNYFAMFVLVVIVGFMFV 430 Query: 422 TPGLSVSVLLVPLWLVVMWAGYAFKRRR 449 P VSV++ LVV Y + R+ Sbjct: 431 NPDTRVSVIVGAAVLVVATLFYVVRHRK 458 Lambda K H 0.327 0.140 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 29 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 462 Length adjustment: 33 Effective length of query: 428 Effective length of database: 429 Effective search space: 183612 Effective search space used: 183612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory