Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_089136363.1 CES79_RS03835 methionine ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_002217945.1:WP_089136363.1 Length = 345 Score = 167 bits (423), Expect = 4e-46 Identities = 91/247 (36%), Positives = 150/247 (60%), Gaps = 5/247 (2%) Query: 7 KNVSKVFK----KGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEL 62 K+VSK FK +V A+ +V+I+++ GE FG++G SGAGK+T +R+I GL+ P+ G + Sbjct: 13 KHVSKTFKGTATTKEVHAVHDVSISVDRGEIFGVIGYSGAGKSTLIRMINGLETPTEGSV 72 Query: 63 YFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVE 122 D++ + K + KIGM+FQ + L T ++NI PL K+ K+EI++R E Sbjct: 73 KVDNQDITQLKKEPLAQLRHKIGMIFQNYNLLKTATIYQNITIPLKLEKIPKDEIQQRAE 132 Query: 123 EVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARAL 182 + KI+ + N +P +LSGGQ QRVA+ARAL +P++LL DE S LD S L Sbjct: 133 KYLKIVGLWDRRNSYPSQLSGGQSQRVAVARALAHEPTILLSDEATSALDPETTSSILDL 192 Query: 183 VKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIG 242 +K++ +LG+T+ +++H+ + +I D+V ++ G +V+ G+ D++ P +G Sbjct: 193 LKDINQKLGLTIFIITHELDVVKSICDKVAIMEAGNVVEQGRTIDVFTGPKQEVTRQFLG 252 Query: 243 EINELEG 249 N+L G Sbjct: 253 S-NDLAG 258 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 345 Length adjustment: 29 Effective length of query: 324 Effective length of database: 316 Effective search space: 102384 Effective search space used: 102384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory