Align ABC transporter for L-Arginine, permease component 2 (characterized)
to candidate WP_094509569.1 CEV31_RS19195 ABC transporter permease subunit
Query= reanno::BFirm:BPHYT_RS07675 (229 letters) >NCBI__GCF_002252445.1:WP_094509569.1 Length = 237 Score = 170 bits (431), Expect = 2e-47 Identities = 89/222 (40%), Positives = 138/222 (62%), Gaps = 3/222 (1%) Query: 5 GFGPVLLAGTIQTIELSVLSLAAAVLLGLAGAAAKLSFNRPLRAIATGYTTLIRSVPDLV 64 G+G G + T+++S ++ A + + GL GA+ KLS NR ++AIA YTT++R++P+L+ Sbjct: 14 GWGDEFAHGLLMTLQVSAVAFAVSFVFGLTGASGKLSRNRFIKAIADLYTTVVRALPELL 73 Query: 65 LMLLLFYSIQIAVNNLTDALNLP--QFDIDPFVAGVLTLGFIYGAYFTETFRGAFLAVPR 122 ++LLL++S+ L A L F F A ++ L F+ GA+ TE R ++LA+PR Sbjct: 74 VILLLYFSVATGAEKLLKATGLVGNNFQFSAFWAAIIALAFVNGAFMTEVLRASYLAIPR 133 Query: 123 GQLEAGSAYGMSGARVFTRILFPQMMRFALPGIGNNWQVLVKATALVSIIG-LADVVKAA 181 GQ+EA + GM ++F R+ FPQMMR A+PGIGN W + K +A++S++G +++ Sbjct: 134 GQIEAALSIGMRRRQIFLRVTFPQMMRHAVPGIGNLWLSITKESAIISVLGSFHELLYTG 193 Query: 182 QDAGKSTFNMFFFILVAALIYLAITTASNLVLIWLEKRYSIG 223 A ST FF + A ++L IT S LV+I LEKR S G Sbjct: 194 YRAAASTKQYVFFYGLTAFLFLCITLVSVLVIIQLEKRLSRG 235 Lambda K H 0.329 0.142 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 237 Length adjustment: 23 Effective length of query: 206 Effective length of database: 214 Effective search space: 44084 Effective search space used: 44084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory