Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_094509571.1 CEV31_RS19200 ABC transporter permease subunit
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_002252445.1:WP_094509571.1 Length = 233 Score = 119 bits (298), Expect = 5e-32 Identities = 74/220 (33%), Positives = 124/220 (56%), Gaps = 4/220 (1%) Query: 7 SSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVFRSI 66 + I+ LP L+ L +TL +T TA VIG+++GT+ A+ LS + W A +Y +FR Sbjct: 5 TKIIEFLPPLIKALPLTLLLTATAGVIGLVFGTLSALALLSKRRILKWPAFSYTFIFRGT 64 Query: 67 PLVMVLLWFYL----IVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQS 122 PL++ L Y I+PG L P L A+ A S+ + AY +E+IR I+S Sbjct: 65 PLLVQLYLIYYGLGQILPGTWVRHSFLWPYMRDGLWYAVFALSLNQGAYNAEVIRGAIKS 124 Query: 123 ISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFR 182 I RGQ AAL++GM+ ++ ++ I LP AFR +P+L + I+L + TSL +++ + Sbjct: 125 IPRGQIEAALSIGMSRFKVLRRITLPLAFRHCMPVLTSDLIILLKSTSLASTITIMEVMG 184 Query: 183 TASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR 222 TA + + E ++ AG +YF + + +++ ++RR Sbjct: 185 TARALQRSSLSIFEPLIAAGILYFTVVFILTRIMNVVERR 224 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 233 Length adjustment: 23 Effective length of query: 201 Effective length of database: 210 Effective search space: 42210 Effective search space used: 42210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory