Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_094509571.1 CEV31_RS19200 ABC transporter permease subunit
Query= TCDB::Q88NY3 (248 letters) >NCBI__GCF_002252445.1:WP_094509571.1 Length = 233 Score = 105 bits (262), Expect = 8e-28 Identities = 68/220 (30%), Positives = 118/220 (53%), Gaps = 5/220 (2%) Query: 21 YLDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLLVQ 80 +L I L T+ + TA +I L+ G+L + R++ A +Y +FR PLLVQ Sbjct: 10 FLPPLIKALPLTLLLTATAGVIGLVFGTLSALALLSKRRILKWPAFSYTFIFRGTPLLVQ 69 Query: 81 LFIWYFLVPDLLPEGLQEWFKQD-LNP-TTSALISVVICLGLFTAARVCEQVRTGIQALP 138 L++ Y+ + +LP W + L P L V L L A E +R I+++P Sbjct: 70 LYLIYYGLGQILPG---TWVRHSFLWPYMRDGLWYAVFALSLNQGAYNAEVIRGAIKSIP 126 Query: 139 KGQEAAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELLAQT 198 +GQ AA ++G S ++ + LP A+R +P LTS+ + + K++S+AS I +ME++ Sbjct: 127 RGQIEAALSIGMSRFKVLRRITLPLAFRHCMPVLTSDLIILLKSTSLASTITIMEVMGTA 186 Query: 199 KQTAEFSANLFEAFTLATLIYFTLNMGLMLLMRMVEKKVA 238 + S ++FE A ++YFT+ L +M +VE++++ Sbjct: 187 RALQRSSLSIFEPLIAAGILYFTVVFILTRIMNVVERRMS 226 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 233 Length adjustment: 23 Effective length of query: 225 Effective length of database: 210 Effective search space: 47250 Effective search space used: 47250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory