Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_094508577.1 CEV31_RS15105 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN4 (268 letters) >NCBI__GCF_002252445.1:WP_094508577.1 Length = 282 Score = 186 bits (473), Expect = 4e-52 Identities = 109/266 (40%), Positives = 167/266 (62%), Gaps = 10/266 (3%) Query: 1 MSRLV--VKNLTKIFSL---GFFSKR-RIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAK 54 MS+L+ V+++ + + L F SK + + VS E++ + + +VGESGSGK+T A+ Sbjct: 1 MSKLILQVRDVVREYQLPRLSFLSKPGSLRVLHGVSVEIEAGQSLGIVGESGSGKSTLAR 60 Query: 55 MILRLLPPTSGEIYFEGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQ 114 ++ L P SG+I G+DI+ DR SL E R+ A+FQDP+ S +P + V R + + Sbjct: 61 AVMGLERPQSGQILINGQDIYA--LDRSSLREARKGFQAIFQDPYGSLDPRHTVRRIISE 118 Query: 115 AISLLENKPSNKKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPL 174 I LE S+K E + + E L VG+ PK KYPH+ SGGQ+QRI IAR I +P Sbjct: 119 PIVSLERGTSSK-ERNDRVAEVLEAVGL-PKASAEKYPHEFSGGQRQRIAIARALITKPA 176 Query: 175 LIVADEPTSMIDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIV 234 LIVADEP S +D S + ++ L+ +L+E+ G S +FI+HDLG+ ++D + V+ +G IV Sbjct: 177 LIVADEPVSALDVSIQAQVLNLMMDLQEKFGLSYLFISHDLGVVRAITDRVAVIYHGNIV 236 Query: 235 ERGHPDKVVLEPTHEYTKLLVGSIPK 260 E+G ++V P H+YT+ LV ++PK Sbjct: 237 EQGPTNEVFDSPQHDYTRALVDAVPK 262 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 282 Length adjustment: 25 Effective length of query: 243 Effective length of database: 257 Effective search space: 62451 Effective search space used: 62451 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory