Align TM0030, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_094509497.1 CEV31_RS18995 ABC transporter permease
Query= TCDB::Q9WXN7 (338 letters) >NCBI__GCF_002252445.1:WP_094509497.1 Length = 312 Score = 165 bits (418), Expect = 1e-45 Identities = 106/329 (32%), Positives = 172/329 (52%), Gaps = 21/329 (6%) Query: 7 FKYLLRRFIFLLVTYIVATTIVFILPRAIPGNPLSQILSGLSRVAQANPEAIRAAERTLM 66 F+++LRR + LL + I F+L R IPG+P +L +A P AI + Sbjct: 4 FQFVLRRPLQLLPVLFGISVITFVLVRLIPGDPARVLLG-----TRATPAAIA----NIR 54 Query: 67 EEFGLGKPWYVQYFEFITKALRGDLGTSITFYPRKVIDLIIPVIPWTLILLLPATIVAWI 126 ++GL +P ++QY F+ G++G SI Y V+ LI I TL+L++ + I++ + Sbjct: 55 AQYGLDEPMWLQYLYFLRNIANGEMGKSI-LYKIDVLKLIATRIEPTLMLVICSVILSIL 113 Query: 127 LGNSLGALAAYKRNTWIDKGVLTTSLIVSQIPYYWLGMIFIFLFGVKLGWLPVQGAYSQG 186 + L A+AA + D + T S P +WL ++ I LF VKL LPV G + Sbjct: 114 IAVPLAAIAARQNGKLSDHVIRTVSTFGIGFPPFWLALMLIILFSVKLDLLPVSGYGNT- 172 Query: 187 TIPNLSWSFFVDVLKHYIMPFASIVVSAMGGWAIGMRLMVIYELGSDYAMFSEYLGMKDK 246 F + L H I+P +I +S A +R +I L SD A + GM + Sbjct: 173 ---------FKEKLAHLILPSLTIALSLSTVLARSLRAAMIQSLNSDVATAARARGMPES 223 Query: 247 RIF-KYVFRNSLLPQITGLALSLGGVLGGALITEIVFNYPGTGYLLFRALTTLDYPLIQG 305 +F ++V NSL+P + LA+++G ++G ++ E VF PG G LL RA+ + DY ++QG Sbjct: 224 IVFWRHVLPNSLVPTVNLLAVNIGWLIGSTVVVESVFALPGMGQLLVRAIFSRDYMVVQG 283 Query: 306 IFVILIASIYLANFIVDFLYALIDPRIRL 334 + ++ + L NF+ D +DPR++L Sbjct: 284 VAMVFACATVLVNFMADIATVALDPRVKL 312 Lambda K H 0.329 0.146 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 312 Length adjustment: 28 Effective length of query: 310 Effective length of database: 284 Effective search space: 88040 Effective search space used: 88040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory