Align cytochrome c component of deoxyribose dehydrogenase (characterized)
to candidate WP_094506618.1 CEV31_RS08410 cytochrome c
Query= reanno::WCS417:GFF2133 (447 letters) >NCBI__GCF_002252445.1:WP_094506618.1 Length = 313 Score = 135 bits (341), Expect = 1e-36 Identities = 106/333 (31%), Positives = 155/333 (46%), Gaps = 45/333 (13%) Query: 4 RRFARTAGWLALPCLVAAGLLAWYVTREPATPFEQEQAGATFEPALVSRGEYVARLSDCV 63 R+ A AG L+ G ++V P T + A+ +P ++GE V C Sbjct: 3 RKLAYAAG-----ALIIIGAATFWVLTTPQTV--DQTVIASLQPGDAAKGEQVFWAGGCA 55 Query: 64 ACHSLAG-----KAPFAGGLEMATPLGAIHATNITPDKSTGIGTYSLADFDRAVRHGVAP 118 +CH+ G + AGG E+A+ G A NI+P + GIGT++L DF A+ GV Sbjct: 56 SCHAAPGATGDARKVMAGGHELASDFGTFIAPNISPSQQ-GIGTWTLHDFANAILKGVGT 114 Query: 119 GGRRLYPAMPYPSYVKLSDDDIKALYAFFMQGIKPANQPNIPSDIPWPLNMRWPIALWNG 178 G LYP+ PY SY K+ D+ L+A +M+ + ++ + +P N+R + LW Sbjct: 115 KGEHLYPSFPYTSYAKMQPQDVADLFA-YMKTLPESDNVAAEHKLGFPFNIRRGLGLWKQ 173 Query: 179 VF---APTATYAAKPDQDALWNRGAYIVQGPGHCGSCHTPRGLAFNEKALDEAGAPFLAG 235 ++ P A DQ RG Y+ + GHC CHTPR + LD ++AG Sbjct: 174 LYLSDKPVVELANASDQ---VKRGKYLTEALGHCAECHTPRSVI---GGLDT--TQWMAG 225 Query: 236 ALLDGWYAPSLRQD------PNT-----GLGRWSEPQIVQFLKTGRNA-HAVVYGSMTEA 283 AL +P D PN G+G WSE I L++G + GSMT+ Sbjct: 226 AL-----SPETGSDGRKGIVPNITAGEGGIGDWSENDIAYALQSGFTPDFDSLGGSMTDV 280 Query: 284 FNNSTQFMQDDDLAAIARYLKSLPGDPQRDGAP 316 N + D D AIA YLK++P +DG P Sbjct: 281 VTNMAH-LTDADREAIAAYLKAIPA--HKDGYP 310 Lambda K H 0.318 0.133 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 313 Length adjustment: 30 Effective length of query: 417 Effective length of database: 283 Effective search space: 118011 Effective search space used: 118011 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory