Align Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 (characterized)
to candidate WP_094506618.1 CEV31_RS08410 cytochrome c
Query= SwissProt::Q47945 (478 letters) >NCBI__GCF_002252445.1:WP_094506618.1 Length = 313 Score = 143 bits (361), Expect = 7e-39 Identities = 102/313 (32%), Positives = 158/313 (50%), Gaps = 30/313 (9%) Query: 19 KLAAAIGLMAVSFGAAH------AQDADEALIK--------RGEYVARLSDCIACHTALH 64 KLA A G + + GAA Q D+ +I +GE V C +CH A Sbjct: 4 KLAYAAGALII-IGAATFWVLTTPQTVDQTVIASLQPGDAAKGEQVFWAGGCASCHAAPG 62 Query: 65 G-----QPYAGGLEIKSPIGTIYSTNITPDPEHGIGNYTLEDFTKALRKGIRKDGATVYP 119 + AGG E+ S GT + NI+P + GIG +TL DF A+ KG+ G +YP Sbjct: 63 ATGDARKVMAGGHELASDFGTFIAPNISPS-QQGIGTWTLHDFANAILKGVGTKGEHLYP 121 Query: 120 AMPYPEFARLSDDDIRAMYAFF--MHGVKPVALQNKAPDISWPLSMRWPLGMWRAMFVPS 177 + PY +A++ D+ ++A+ + VA ++K + +P ++R LG+W+ +++ S Sbjct: 122 SFPYTSYAKMQPQDVADLFAYMKTLPESDNVAAEHK---LGFPFNIRRGLGLWKQLYL-S 177 Query: 178 MTPGVDKSISDPEVARGEYLVNGPGHCGECHTPRGFGMQVKAYGTAGGNAYLAGGAPIDN 237 P V+ + + +V RG+YL GHC ECHTPR + G G+ Sbjct: 178 DKPVVELANASDQVKRGKYLTEALGHCAECHTPRSVIGGLDTTQWMAGALSPETGSDGRK 237 Query: 238 WIAPSLRSNSDTGLGRWSEDDIVTFLKSG-RIDHSAVFGGMADVVAYSTQHWSDDDLRAT 296 I P++ + + G+G WSE+DI L+SG D ++ G M DVV + H +D D A Sbjct: 238 GIVPNITA-GEGGIGDWSENDIAYALQSGFTPDFDSLGGSMTDVVT-NMAHLTDADREAI 295 Query: 297 AKYLKSMPAVPEG 309 A YLK++PA +G Sbjct: 296 AAYLKAIPAHKDG 308 Lambda K H 0.317 0.134 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 478 Length of database: 313 Length adjustment: 30 Effective length of query: 448 Effective length of database: 283 Effective search space: 126784 Effective search space used: 126784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory