Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate WP_094506618.1 CEV31_RS08410 cytochrome c
Query= BRENDA::C7G3B8 (472 letters) >NCBI__GCF_002252445.1:WP_094506618.1 Length = 313 Score = 131 bits (330), Expect = 3e-35 Identities = 98/317 (30%), Positives = 150/317 (47%), Gaps = 38/317 (11%) Query: 2 MINRLKAALGA-VAVGLLAGTSLAHAQNADEDLIK--------KGEYVARLGDCVACHTS 52 M+ +L A GA + +G L Q D+ +I KGE V G C +CH + Sbjct: 1 MVRKLAYAAGALIIIGAATFWVLTTPQTVDQTVIASLQPGDAAKGEQVFWAGGCASCHAA 60 Query: 53 LNG-----QKYAGGLSIKTPIGTIYSTNITPDPTYGIGTYTFKEFDEAVRHGVRKDGATL 107 + AGG + + GT + NI+P GIGT+T +F A+ GV G L Sbjct: 61 PGATGDARKVMAGGHELASDFGTFIAPNISPSQQ-GIGTWTLHDFANAILKGVGTKGEHL 119 Query: 108 YPAMPYPSFARMTQDDMKALYAYF--MHGAQPIAQKNHPTDISWPMSMRWPLSIWRSVFA 165 YP+ PY S+A+M D+ L+AY + + +A ++ + +P ++R L +W+ ++ Sbjct: 120 YPSFPYTSYAKMQPQDVADLFAYMKTLPESDNVAAEH---KLGFPFNIRRGLGLWKQLYL 176 Query: 166 PAPKDFTPAPGTDAEIARGEYLVTGPGHCGACHTPRGF--GMQEK-----ALDASGGPDF 218 + K ++ RG+YL GHC CHTPR G+ AL G D Sbjct: 177 -SDKPVVELANASDQVKRGKYLTEALGHCAECHTPRSVIGGLDTTQWMAGALSPETGSD- 234 Query: 219 LGGGGVIDNWIAPSLRNDPVLGLGRWSDEDLFLFLKSGRT-DHSAAFGGMADVVGWSTQY 277 G G++ N A G+G WS+ D+ L+SG T D + G M DVV + + Sbjct: 235 -GRKGIVPNITAGE------GGIGDWSENDIAYALQSGFTPDFDSLGGSMTDVV-TNMAH 286 Query: 278 FTDADLHAMVKYIKSLP 294 TDAD A+ Y+K++P Sbjct: 287 LTDADREAIAAYLKAIP 303 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 313 Length adjustment: 30 Effective length of query: 442 Effective length of database: 283 Effective search space: 125086 Effective search space used: 125086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory