Align MFS transporter, FHS family, L-fucose permease (characterized, see rationale)
to candidate WP_094509845.1 CEV31_RS19855 sugar MFS transporter
Query= uniprot:A0A1I2JXG1 (442 letters) >NCBI__GCF_002252445.1:WP_094509845.1 Length = 415 Score = 415 bits (1067), Expect = e-120 Identities = 219/410 (53%), Positives = 283/410 (69%), Gaps = 15/410 (3%) Query: 24 DYPMAMGVLTSIFFMWGFLTCLNDILIPHLKAVFKLNYAEAMLVQFTFFGAYFLMSLPAG 83 +Y A+ LT +FFMWGF+TCLNDILIPHLK VF+LNY ++ML+QF FFGAYF++SLPAG Sbjct: 20 NYSFALASLTMLFFMWGFITCLNDILIPHLKNVFQLNYFQSMLIQFCFFGAYFIVSLPAG 79 Query: 84 LLVARLGYKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLGALFVLATGITVLQVAANAYV 143 LV R+ YK GIV GL VA VG A F PAA+ Y FLGALFVLA+G+T+LQVAAN YV Sbjct: 80 ALVKRISYKWGIVTGLVVAAVGCALFIPAASYQVYALFLGALFVLASGVTILQVAANPYV 139 Query: 144 ALLGPEKSASSRLTLAQALNSLGTFLAPKFGGLLILSAAVLSAEQIAKLSPAEQVAYRVQ 203 +LG ++A+SRLTL QA NSLGT +AP FG LILSAA A A Sbjct: 140 TILGAPETAASRLTLTQAFNSLGTTIAPIFGAFLILSAATSDAASSA------------- 186 Query: 204 EAQTVQGPYLGLAIVLFLLAVFVYLFRLPALTEKTEQASVKQHSLVSPLRHPHVLFGVLA 263 +A VQ PYL LA+ +LA+ + +LP + E E+ +V S ++ H++ G + Sbjct: 187 DANAVQFPYLLLALAFAVLAIVFAILKLPNVQE--EETAVISKEEGSAWQYRHLVLGSIG 244 Query: 264 IFFYVGGEVAIGSFLVNYLSMPDIGNMSEQAAANWVAYYWLGAMIGRFIGSALLAKLSPR 323 +F YVG EV+IGSFLVN+LS P + M+E AA++VAY+W GAMI RFIG+ + + Sbjct: 245 LFVYVGAEVSIGSFLVNFLSDPTVAGMAEAEAAHYVAYFWGGAMIARFIGAVAMRYVDDG 304 Query: 324 KLLAIFAAINMALVLTTMMTKGTVAMYSVVSIGLFNSIMFPTIFSLGIERMGPMTGEASS 383 K LA AA + L+L T+ T G VAM+SV++IGLFNSIMFPTIFSL + +G T + S Sbjct: 305 KALAFNAATAIILLLITVATTGHVAMWSVLAIGLFNSIMFPTIFSLALHGLGKHTSQGSG 364 Query: 384 LLIMAIVGGAIVPFVQGLFADHIGVQHAFFLPLLCYAYIVFYGLYGSRIK 433 +L +AIVGGAI+P VQG AD +G+ AF +P++CY YI +YGL GS+ K Sbjct: 365 ILCLAIVGGAIIPLVQGALADSVGIHLAFLMPIVCYIYIAYYGLVGSKPK 414 Lambda K H 0.327 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 415 Length adjustment: 32 Effective length of query: 410 Effective length of database: 383 Effective search space: 157030 Effective search space used: 157030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory