Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate WP_094506262.1 CEV31_RS06770 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21105 (288 letters) >NCBI__GCF_002252445.1:WP_094506262.1 Length = 292 Score = 508 bits (1308), Expect = e-149 Identities = 245/286 (85%), Positives = 267/286 (93%) Query: 3 TNASHRLRRRLLKVAHLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLD 62 +N HRL RR+ KVA+L GLFLAM +ICLPGLWIVLSSLRP VEIMAKPPVWIP+ ++LD Sbjct: 7 SNDQHRLLRRVKKVAYLIGLFLAMTIICLPGLWIVLSSLRPPVEIMAKPPVWIPQEITLD 66 Query: 63 AYRAMFSGAGQGGVPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGF 122 AY AMFSGAG GG+PVWDYFRNSLI+SVTST+IAL +G+SGGYAFAR+RF KS FLG Sbjct: 67 AYYAMFSGAGGGGIPVWDYFRNSLIISVTSTIIALVVGVSGGYAFARFRFWGKSTTFLGL 126 Query: 123 MLTRAVPGIALSLPLFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLAE 182 MLTR+VPGIALSLPLFMLY+R GIIDTHF LI+TYVALNVPFTIWLIDGFFRQVPKDLAE Sbjct: 127 MLTRSVPGIALSLPLFMLYSRIGIIDTHFGLIITYVALNVPFTIWLIDGFFRQVPKDLAE 186 Query: 183 AAQIDGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGLL 242 AAQIDGCT WQAFWQVEFPLAGPGIA+AGIFAFLTSWNEYALASQ+TRS+NSKTLPVGLL Sbjct: 187 AAQIDGCTRWQAFWQVEFPLAGPGIATAGIFAFLTSWNEYALASQLTRSINSKTLPVGLL 246 Query: 243 DYTAEFTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVKG 288 DYTAEFTIDWRGMCALAVVMI+PALTLTFI+QKHLV+GLTFGAVKG Sbjct: 247 DYTAEFTIDWRGMCALAVVMIIPALTLTFIVQKHLVAGLTFGAVKG 292 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 292 Length adjustment: 26 Effective length of query: 262 Effective length of database: 266 Effective search space: 69692 Effective search space used: 69692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory