Align N-acetylglucosamine transporter nagP (characterized)
to candidate WP_094509845.1 CEV31_RS19855 sugar MFS transporter
Query= reanno::ANA3:7025962 (432 letters) >NCBI__GCF_002252445.1:WP_094509845.1 Length = 415 Score = 201 bits (510), Expect = 5e-56 Identities = 137/425 (32%), Positives = 216/425 (50%), Gaps = 26/425 (6%) Query: 4 DKSQQKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTF 63 D K+ +A + LFF+ GF T LN L+P+LK + QLN FQ+ LI F F+ A Sbjct: 14 DAPSGKNYSFALASLTMLFFMWGFITCLNDILIPHLKNVFQLNYFQSMLIQFCFFGAYFI 73 Query: 64 TALPSAWVIRKVGYKNGMALGMGIMMLAGLLFIPAAKTQIFGLFLCAQLVMGTGQTLLQT 123 +LP+ +++++ YK G+ G+ + + LFIPAA Q++ LFL A V+ +G T+LQ Sbjct: 74 VSLPAGALVKRISYKWGIVTGLVVAAVGCALFIPAASYQVYALFLGALFVLASGVTILQV 133 Query: 124 AVNPYVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQIDE 183 A NPYV LG E+AA+R+++ N IAP+ + LIL + ++ Sbjct: 134 AANPYVTILGAPETAASRLTLTQAFNSLGTTIAPIFGAFLILSAATSDAASSAD------ 187 Query: 184 MANSLVFPYLGMAIFIGVLALAVKKSPLPELSNEDEVAEHTDKGQIKAALSHPNLAFGVI 243 AN++ FPYL +A+ VLA+ LP + E+ ++G +A + +L G I Sbjct: 188 -ANAVQFPYLLLALAFAVLAIVFAILKLPNVQEEETAVISKEEG---SAWQYRHLVLGSI 243 Query: 244 ALFVYVAVEVIAGDTIGTFALSLGVEHYGVMTSYTMVCMVLGYTLGIILIPRFISQPTAL 303 LFVYV EV +IG+F ++ + + + Y G +I RFI Sbjct: 244 GLFVYVGAEV----SIGSFLVNFLSDPTVAGMAEAEAAHYVAYFWGGAMIARFIGAVAMR 299 Query: 304 MISAILGLLLTLAILFGDNNSYAIANALLVPFGGVALPDTLLFIAFLGLANAIVWPAVWP 363 + A+ F + + + G VA+ L +GL N+I++P ++ Sbjct: 300 YVDD------GKALAFNAATAIILLLITVATTGHVAMWSVLA----IGLFNSIMFPTIFS 349 Query: 364 LALSGLGKLTSTGSALLIMGIAGGAFGPLFWGLTSSATDMGQQGGYMVMLPCYLFILFYA 423 LAL GLGK TS GS +L + I GGA PL G + A +G +++ + CY++I +Y Sbjct: 350 LALHGLGKHTSQGSGILCLAIVGGAIIPLVQG--ALADSVGIHLAFLMPIVCYIYIAYYG 407 Query: 424 VKGHK 428 + G K Sbjct: 408 LVGSK 412 Lambda K H 0.327 0.141 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 415 Length adjustment: 32 Effective length of query: 400 Effective length of database: 383 Effective search space: 153200 Effective search space used: 153200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory