Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate WP_094509293.1 CEV31_RS18370 TRAP transporter large permease
Query= uniprot:Q88NP0 (426 letters) >NCBI__GCF_002252445.1:WP_094509293.1 Length = 425 Score = 326 bits (836), Expect = 7e-94 Identities = 161/422 (38%), Positives = 269/422 (63%), Gaps = 2/422 (0%) Query: 5 ILLGSFIVLILIGMPVAYALGLSALIGAWWIDIPLQAMMIQVASGVNKFSLLAIPFFVLA 64 +LLG+F++ + IG+PVA LGLS++ + DIPL + ++ +G++ F LL IP F+LA Sbjct: 5 LLLGTFVLGLAIGLPVAVTLGLSSMAYLLFADIPLVVIPQKMYAGMDSFVLLCIPGFILA 64 Query: 65 GAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSVLIPE 124 G +M GG++ R++ FA LVG++RGGL+ NI AS FG ISG++VAD ASVG ++IP Sbjct: 65 GNLMNSGGITERIIRFANALVGWMRGGLAQANIAASMLFGGISGTAVADVASVGGMMIPG 124 Query: 125 MERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGLLLSA 184 M++ GYP +FS AVT + S + PPS ++ +G +S+ LF+AG MPGLL+ Sbjct: 125 MKKVGYPADFSAAVTAASSTVGPMIPPSVPMIIVGSLSG--LSVGKLFLAGAMPGLLMGF 182 Query: 185 VMMGLCLIFAKKRNYPKGEVIPLREALKIAGEALWGLMAMVIILGGILSGVFTATESAAV 244 MM AKK+N+P+ +RE A+W + +I+GG+L GV T TE+A V Sbjct: 183 AMMVTTYFIAKKKNFPRENWKGVRELFTSFTGAIWAIAMTALIVGGLLIGVTTPTETAVV 242 Query: 245 AVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPSKITT 304 A +++ V +FIYR+ +PK++ + + + +++L+G A FG+++ +IP + Sbjct: 243 ACLYAALVGLFIYRELPVSRIPKIIIDSAISSAGILVLVGTANVFGWILVAERIPQALAD 302 Query: 305 AFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGMIMLV 364 A L+++DN++++++ IN +L+ +G M+ ++IL L + +G+DP+HF ++ Sbjct: 303 AVLSVTDNKFLVILLINLLLLFVGMFMETIAALIILFVPLQALAIAVGIDPIHFACFAVL 362 Query: 365 NLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLWLPSV 424 NL IGL TPPVG LFV S I ++ + ++A++P+ + +VL+ V+Y P ++ WLP+ Sbjct: 363 NLMIGLTTPPVGVCLFVASNIARLPLSPVIRAIIPYIITNIIVLLMVSYFPPLATWLPNT 422 Query: 425 VL 426 ++ Sbjct: 423 LM 424 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 598 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 425 Length adjustment: 32 Effective length of query: 394 Effective length of database: 393 Effective search space: 154842 Effective search space used: 154842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory