Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate WP_094509571.1 CEV31_RS19200 ABC transporter permease subunit
Query= uniprot:B2TBJ8 (250 letters) >NCBI__GCF_002252445.1:WP_094509571.1 Length = 233 Score = 161 bits (407), Expect = 1e-44 Identities = 84/224 (37%), Positives = 140/224 (62%), Gaps = 11/224 (4%) Query: 8 LFDTIKQLLAAVPTTLGLFFCS----LILGGLLSLVIVTMRVSPHWLPNRFARAYILVFR 63 + + + L+ A+P TL L + L+ G L +L +++ R W A +Y +FR Sbjct: 7 IIEFLPPLIKALPLTLLLTATAGVIGLVFGTLSALALLSKRRILKWP----AFSYTFIFR 62 Query: 64 GSPLLIQMFLVYYGMGQF---GVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGL 120 G+PLL+Q++L+YYG+GQ +R SFLWP +R+ AV +L+L Y AE+IRG + Sbjct: 63 GTPLLVQLYLIYYGLGQILPGTWVRHSFLWPYMRDGLWYAVFALSLNQGAYNAEVIRGAI 122 Query: 121 MAVPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEV 180 ++P GQIEA SIG+S F +LRR+ P+A R C+P +++ ++L+KST+LAS +T+ EV Sbjct: 123 KSIPRGQIEAALSIGMSRFKVLRRITLPLAFRHCMPVLTSDLIILLKSTSLASTITIMEV 182 Query: 181 TGVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGMLETRLS 224 G A+ + + + E I A ++Y + F++ R++ ++E R+S Sbjct: 183 MGTARALQRSSLSIFEPLIAAGILYFTVVFILTRIMNVVERRMS 226 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 233 Length adjustment: 23 Effective length of query: 227 Effective length of database: 210 Effective search space: 47670 Effective search space used: 47670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory