Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_094507331.1 CEV31_RS10995 acetyl-CoA carboxylase biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_002252445.1:WP_094507331.1 Length = 452 Score = 397 bits (1020), Expect = e-115 Identities = 216/459 (47%), Positives = 295/459 (64%), Gaps = 12/459 (2%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 F ++L+ANRGEIA RVL+A KE+G+ +AV+S AD A+H + ADE+ IG P+ DSYL Sbjct: 2 FQKILIANRGEIALRVLRACKELGIKTVAVHSTADADAMHVRLADESVCIGPPPSRDSYL 61 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 NI I+ A E DAIHPGYGFLSENA+FAE +E ITFIGP+S +R + DK++ KR Sbjct: 62 NIHQIVAACEITGADAIHPGYGFLSENAKFAEILEAHSITFIGPTSAHIRTMGDKIEAKR 121 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 A G+P PGSDG VT +EA ++A++IGYP+++KA++GGGG G+ +D L Sbjct: 122 TAKRLGIPVVPGSDGGVTDENEAKRIAKEIGYPVIIKASAGGGGRGMKVAKTEDDLAVAL 181 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 + A AFG ++IEKY PRHIE Q++GD GN + ER+C++QRR+QK+ EE Sbjct: 182 ATARTEAGAAFGDDAVYIEKYLEKPRHIEVQVMGDGAGNAIHLGERDCSLQRRHQKVWEE 241 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303 A SPAL E R+ + + Y GT E + + +FYF+E+N RLQVEHP T Sbjct: 242 ANSPALNAEARDKIGMICANAVADMGYRGAGTIEFLYE--NGEFYFIEMNTRLQVEHPVT 299 Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYY 363 E I IDLV QI++AAG L Q+D+ R G AIE RINAED NFT S G +T+Y Sbjct: 300 EAITGIDLVHEQIRVAAGLGLSVKQDDV--RFSGHAIECRINAEDP-RNFTPSPGLITHY 356 Query: 364 REPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIKTT 423 P G G+RVDSG+ SG +PPYYDSL+ KLIV+G +R + RAL ++ + G+KTT Sbjct: 357 HTPGGLGIRVDSGVYSGYRIPPYYDSLIGKLIVHGRNRVECMMRLRRALDEFVVDGVKTT 416 Query: 424 IELYKWIMQDPDFQEGKFSTSYISQKTDQFVKYLREQEE 462 + L++ ++ + D G + ++ KYL +Q E Sbjct: 417 LPLFQDLISNQDIANGDYDIHWLE-------KYLAKQSE 448 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 452 Length adjustment: 34 Effective length of query: 475 Effective length of database: 418 Effective search space: 198550 Effective search space used: 198550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory