Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_094508694.1 CEV31_RS16810 ATP-grasp domain-containing protein
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_002252445.1:WP_094508694.1 Length = 569 Score = 368 bits (945), Expect = e-106 Identities = 186/431 (43%), Positives = 283/431 (65%), Gaps = 4/431 (0%) Query: 6 RVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYLNI 65 ++L+ANRGEIA R+++A + G+ ++A+YS+AD ++H ++ADEAY +G D+YLNI Sbjct: 3 KLLIANRGEIAIRIIRAAADYGVKSVAIYSDADANSLHAEFADEAYGLGAGRPNDTYLNI 62 Query: 66 EHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKRLA 125 I+D A++A DA+HPGYGFLSE AEFA+AV AG+ ++GPS EV+ + DK+ +R+A Sbjct: 63 AKILDIAKRAGADAVHPGYGFLSERAEFAKAVIDAGLMWVGPSPEVITALGDKVAARRIA 122 Query: 126 NMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVWER 185 G P GSDGP+ S EA+ A + G P+ +KAA GGGG G+ + +++ ++++ Sbjct: 123 EQVGAPLVRGSDGPLESAAEAVAFAREAGLPLAIKAAFGGGGRGMKVAYHLEEVGELFDS 182 Query: 186 NKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEEAP 245 R A +AFG+ + + E++ PRHIE Q+I D +GN VV R+C++QRRNQKL+EEAP Sbjct: 183 AVREAVEAFGRGECYAEQFLEKPRHIEAQVIADTHGNTVVLGTRDCSLQRRNQKLVEEAP 242 Query: 246 SPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTTEL 305 +P + ++R + E Y GT E S + FLE+N RLQVEHP TE Sbjct: 243 APFITQDQRNRIHESARAICAAAGYTGAGTVEFLLSQ-NGTISFLEVNTRLQVEHPITEE 301 Query: 306 IFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYYRE 365 +D+V Q+++A G+ L ++ RG A E+RINAED F + G +T +R Sbjct: 302 TTGVDIVIEQLRIADGKKLSVTE---TPEPRGHAFEFRINAEDPGRGFLPTPGLITRFRA 358 Query: 366 PTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIKTTIE 425 P+GPGVR+D+G+ESGS +P YDS+++KLIV+G +RE A+ RALA++ I G+ + + Sbjct: 359 PSGPGVRLDTGVESGSEIPGLYDSMMAKLIVWGATREEALIRARRALAEFHIEGVASVLP 418 Query: 426 LYKWIMQDPDF 436 ++ +++D DF Sbjct: 419 FHRAVVEDKDF 429 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 667 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 569 Length adjustment: 35 Effective length of query: 474 Effective length of database: 534 Effective search space: 253116 Effective search space used: 253116 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory