Align LacF, component of Lactose porter (characterized)
to candidate WP_094507758.1 CEV31_RS14435 sugar ABC transporter permease
Query= TCDB::P29823 (298 letters) >NCBI__GCF_002252445.1:WP_094507758.1 Length = 306 Score = 137 bits (345), Expect = 3e-37 Identities = 89/282 (31%), Positives = 142/282 (50%), Gaps = 11/282 (3%) Query: 18 WLFVAPAIALISVFMLYPILRSLVLSLYT---GRGMMLKFSGTGNLVRLWNDPVFWQALQ 74 WL ++PA+ + V + P+++++ S Y + F G N L DPVFW A Sbjct: 25 WL-LSPAVIVTLVIVFLPMVQAVWTSFYDLLLFKPKATAFIGLANYFNLLQDPVFWAAFW 83 Query: 75 NTVIFFVVQVPIMITMALILAAMLNNPKLRYSGLFRTMIFLPCVSSLVAYSILFKSMFSL 134 NT I+ + VP+ + + LI A +LN + + GL R ++ +P V +++++ ++ Sbjct: 84 NTCIWIGLTVPLQMGLGLITALLLNR-EFPWRGLARALVIIPWALPSVVIALMWRWIYDP 142 Query: 135 D-GVVNNTLLAIGIIGEPIGWLTDPFWAKVLIIIAITWRWTGYNMIFYLAALQNIDRSIY 193 + GV+N LL + ++ + WL DP A II +TW+ + I LA LQ I +S Y Sbjct: 143 NTGVLNEILLNLSVVSHAVPWLADPNIALYAIIATLTWQGFPFFAIMILAGLQGIPKSQY 202 Query: 194 EAAKIDGVPSWGRFAFLTIPMLKPVILFTTITSTIGTLQLFDEVYNFTEGTGGPANSTLT 253 EAA IDG W +F +T+P + PV+ + I D ++ T GGP ST T Sbjct: 203 EAASIDGASPWRQFVNVTLPGIAPVLATAGLLRVIWVANSMDVIFVMT--GGGPGYSTYT 260 Query: 254 LSLYIYNLTFRFMPSFSYAATVSYVIVLMVAVLSFLQFYAAR 295 L LY + + R F Y ++ L++ VL L Y AR Sbjct: 261 LPLYAF-VKARQNLDFGYGTAIAVTFTLLLGVLVVL--YLAR 299 Lambda K H 0.329 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 306 Length adjustment: 27 Effective length of query: 271 Effective length of database: 279 Effective search space: 75609 Effective search space used: 75609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory