Align L-2-aminoadipate aminotransferase monomer (EC 2.6.1.39) (characterized)
to candidate WP_094505093.1 CEV31_RS01220 PLP-dependent aminotransferase family protein
Query= metacyc::MONOMER-6727 (397 letters) >NCBI__GCF_002252445.1:WP_094505093.1 Length = 410 Score = 286 bits (732), Expect = 7e-82 Identities = 166/401 (41%), Positives = 231/401 (57%), Gaps = 13/401 (3%) Query: 4 LSWSEAFGKSAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILR-E 62 L W F + R++AS IRELLKL +RP I+SFAGG+P P LFP E A I Sbjct: 2 LDWESVFATRSKRMRASEIRELLKLLERPDIISFAGGIPDPALFPHNEFQSAYQDIFAGP 61 Query: 63 KGEVALQYSPTEGYAPLRAFVAEW---IGV--RPEEVLITTGSQQALDLVGKVFLDEGSP 117 + ALQYS +EGY PLR ++ IGV + V IT+GSQQALD +GK+F+ Sbjct: 62 EANAALQYSVSEGYKPLRTWLVSELAKIGVPCTEDNVFITSGSQQALDYLGKLFISPNDT 121 Query: 118 VLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRE-RPRFLYLIPSFQNPT 176 L+ AP+Y+GA+QAF P + + E K + +F YL F NPT Sbjct: 122 ALVTAPTYLGALQAFNAYEPSYDILSLNGNRTPASYQEAAEKAGGQVKFAYLSADFSNPT 181 Query: 177 GGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFEL--AREAG---YPGVI 231 G L RK+L+ E + ++ED AY+ L + + S+ L AR G I Sbjct: 182 GETVDLAGRKKLMADADELNVPIIEDAAYQYLRYNGDAVASILSLDIARHGGDIEKTRTI 241 Query: 232 YLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSERLE 291 Y GSFSK L+PGLRV + VA ++KLV KQ ADLH+ +NQ+ ++ + GF ++ Sbjct: 242 YCGSFSKTLAPGLRVGYVVASQSVIRKLVLMKQAADLHSSTINQIAIYHVASRGFDAQVA 301 Query: 292 RVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALE-ENVA 350 ++ VY+ + ML AL + +P+ +T+P+GGMF+W+ LPKG+ L ++E E VA Sbjct: 302 KLHGVYKHRRDKMLEALAKYMPEGTAWTKPEGGMFIWVTLPKGMDGAALLAASIESEKVA 361 Query: 351 FVPGGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRALK 391 FVPG FFA+G G NTLRLSY+ + E I EG+ RLGR ++ Sbjct: 362 FVPGKAFFADGTGANTLRLSYSCANDEMIDEGIMRLGRLIR 402 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 410 Length adjustment: 31 Effective length of query: 366 Effective length of database: 379 Effective search space: 138714 Effective search space used: 138714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory