Align ABC transporter for D-Sorbitol, permease component 2 (characterized)
to candidate WP_094508033.1 CEV31_RS15285 sugar ABC transporter permease
Query= reanno::BFirm:BPHYT_RS16110 (311 letters) >NCBI__GCF_002252445.1:WP_094508033.1 Length = 305 Score = 355 bits (910), Expect = e-102 Identities = 171/287 (59%), Positives = 227/287 (79%) Query: 19 RETRKANSARWLATPSVAVLVLWMAIPLAMTIWFSFSRYNLLNPDLKGFAGFDNYKYLAS 78 +++R++ L P+V VL+LWM +PLAMT+WFSF YNL+NP + GFAG NYK+L S Sbjct: 17 QKSRRSIRTGPLLAPAVIVLLLWMIVPLAMTLWFSFQYYNLINPFVTGFAGVSNYKFLLS 76 Query: 79 DPSFGPSIGHTLELIISVLVITVVGGVLMAILFDRKFYGQGIARLLAIAPFFVMPTVSAL 138 DPS +I +TL L+ SVL+I++ GVL A++FD+ F+G+ IARLL IAPFFVMPTVSAL Sbjct: 77 DPSLWSAIANTLILLGSVLIISIALGVLFAVIFDQDFFGKNIARLLVIAPFFVMPTVSAL 136 Query: 139 IWKNMILHPVYGLIAQGMRAMGMQPIDWFAEYPLTAVIMIVAWQWLPFAFLILFTAIQSL 198 IWKN+++HPV G A R++G+ IDWF+++P+ ++IMIV+WQW+PFA LIL TA+QSL Sbjct: 137 IWKNLLMHPVNGFFAFVSRSLGLPVIDWFSQFPMASIIMIVSWQWVPFATLILMTAMQSL 196 Query: 199 DQEQKEAARIDGAGPFSMFFYITLPHLKRAIAVVVMMETIFLLSIFAEIYTTTGGGPGTA 258 D+EQ EAAR+DGA ++F+YI LPHL R I+VV+M+ETIFLLSIFAEI TT GGPG A Sbjct: 197 DREQMEAARLDGAKGPALFYYIILPHLLRPISVVIMIETIFLLSIFAEILVTTSGGPGIA 256 Query: 259 TTNLSYLIYSLGLQQFDVGLASAGGILAVVLANIVSFFLVRMLAKNL 305 TT L+Y IY L Q+D+G ASA G++A+VLANIV+ FL+R +A+NL Sbjct: 257 TTTLTYFIYLKALLQWDIGGASAAGVIAIVLANIVAIFLIRTVARNL 303 Lambda K H 0.328 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 305 Length adjustment: 27 Effective length of query: 284 Effective length of database: 278 Effective search space: 78952 Effective search space used: 78952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory