Align TRAP dicarboxylate transporter DctP subunit; Flags: Precursor (characterized, see rationale)
to candidate WP_094509297.1 CEV31_RS18380 TRAP transporter substrate-binding protein
Query= uniprot:Q2IUT5 (332 letters) >NCBI__GCF_002252445.1:WP_094509297.1 Length = 324 Score = 131 bits (330), Expect = 2e-35 Identities = 80/253 (31%), Positives = 130/253 (51%), Gaps = 2/253 (0%) Query: 7 VVASIAALALVGPAAAQQPIVVKFSHVVADNTPKGQAAIKFKELAEKYTNGKVKVEVYPN 66 + A+ A LAL+G + Q + +K H+ + +AA+KF + + + G+V VEVYPN Sbjct: 9 IAATCAMLALMGGTSLAQEVTLKLGHLANEENIWHKAALKFADEVKSRSEGRVAVEVYPN 68 Query: 67 SQLFGDAKEMEAVALGDVQFIAPSLSKFDKFTKQIQVFDLPFLFNDIAAVDRFQAGKQGQ 126 L + + + LG S + + + LP+ + + +D +G G+ Sbjct: 69 ESLGKEIDVINGMQLGTADMTITGES-LQNWAPKAALLALPYGYKSLEHMDTVASGDIGK 127 Query: 127 AL-LRSMESKNFLGLAYWHNGMKQISANRPLLKPEDAKGLKFRIQASDILAAQFQGLNAT 185 + +E L Y+ G + +SANR + KPED KG K R+ I A +Q L A Sbjct: 128 QIEAEIIEKAGIRPLTYFARGPRNLSANREITKPEDLKGFKVRVPNVPIFVAAWQALGAN 187 Query: 186 PQKLAFSEVYQALQVGTVDGQENTWSNIFSQKFYEVQKDITESDHGVIDYMVVVNAKWWN 245 P +AFSEV+ +LQ GT++GQEN + S FYEVQK I +++H + ++ + W Sbjct: 188 PTPMAFSEVFTSLQNGTIEGQENPLALFKSGGFYEVQKVINKTEHVRSWIYLTISDRSWG 247 Query: 246 GLSKDLQDAMKKA 258 LS+ Q A+ +A Sbjct: 248 KLSEADQAALIEA 260 Lambda K H 0.316 0.129 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 324 Length adjustment: 28 Effective length of query: 304 Effective length of database: 296 Effective search space: 89984 Effective search space used: 89984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory