Align 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 (characterized)
to candidate WP_094509359.1 CEV31_RS18545 2-dehydro-3-deoxy-6-phosphogalactonate aldolase
Query= SwissProt::Q6BF16 (205 letters) >NCBI__GCF_002252445.1:WP_094509359.1 Length = 206 Score = 181 bits (459), Expect = 8e-51 Identities = 96/194 (49%), Positives = 130/194 (67%) Query: 9 LIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPQWEQSIPAIVDAYGDKALIGAGTVL 68 LIAILRGI P+E A A+I+AG+ +E+PLNSP +SI + +GD ALIGAGTVL Sbjct: 12 LIAILRGIKPEEVEAVGEALIEAGWRILEVPLNSPDPLKSIEKLQRRFGDYALIGAGTVL 71 Query: 69 KPEQVDALARMGCQLIVTPNIHSEVIRRAVGYGMTVCPGCATATEAFTALEAGAQALKIF 128 P QV +A G ++I++PN + VI+ +V M PG AT TEAF A++AGA A+K F Sbjct: 72 TPAQVADVAATGSKVIISPNANLSVIKASVSRDMVSLPGVATPTEAFAAIDAGASAVKAF 131 Query: 129 PSSAFGPQYIKALKAVLPSDIAVFAVGGVTPENLAQWIDAGCAGAGLGSDLYRAGQSVER 188 P+ A P I+A KAVLP++ VFAVGG+TP N+ +IDAG AG G+G LY+ G + + Sbjct: 132 PAEAIPPNVIRAWKAVLPAETPVFAVGGITPNNMKAYIDAGAAGFGIGGALYKPGDTAKL 191 Query: 189 TAQQAAAFVKAYRE 202 + +A F+KA E Sbjct: 192 VSLKAIQFIKATSE 205 Lambda K H 0.319 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 206 Length adjustment: 21 Effective length of query: 184 Effective length of database: 185 Effective search space: 34040 Effective search space used: 34040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory