Align ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized)
to candidate WP_094508947.1 CEV31_RS17420 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc03063 (380 letters) >NCBI__GCF_002252445.1:WP_094508947.1 Length = 278 Score = 115 bits (287), Expect = 2e-30 Identities = 73/231 (31%), Positives = 120/231 (51%), Gaps = 10/231 (4%) Query: 150 TLDNYAEVLSAAGIGRSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVLLAVVVG 209 TL+NY E L RS NS+ + STV+ ++I AYAL+ L +++ Sbjct: 57 TLENY-EGLVTERFMRSMWNSIVTSTVSTVLALVIGIPGAYALSRASLKRDRSLSLLILA 115 Query: 210 LLVVPLQMSLIPLLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPRE 269 + P IP +Y +G T G+ + + F L L ++L+RN+ PRE Sbjct: 116 SRMAPPVAFAIPYFLVYRNLGIL-----DTKTGLIIVYLTFNLALVVWLMRNFFDATPRE 170 Query: 270 IMESARVDGASDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGDDKLVLT 329 + E+A +DGAS + F++I+LP+S PA+ + + FL++WND A+ ++ + Sbjct: 171 LEEAAWIDGASLWGTFIRIVLPMSGPAVVTTGMLCFLYSWNDFFFALTL--TRNNAMTAP 228 Query: 330 GRLVNLLGSRGGNWEILTASAFITIVVPLIVFFALQR-YLVRGLLAGSVKG 379 +VN + G W + A + I+ P+++F L R YLV G+ AG+VKG Sbjct: 229 VEVVNFMNYEGWEWGKIAAGGTL-IMAPVLIFSLLMRKYLVAGMTAGAVKG 278 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 278 Length adjustment: 28 Effective length of query: 352 Effective length of database: 250 Effective search space: 88000 Effective search space used: 88000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory