GapMind for catabolism of small carbon sources

 

Protein WP_094573760.1 in Ochrobactrum rhizosphaerae PR17

Annotation: NCBI__GCF_002252475.1:WP_094573760.1

Length: 375 amino acids

Source: GCF_002252475.1 in NCBI

Candidate for 23 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism malK med Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 58% 99% 407.9 ABC transporter for D-Sorbitol, ATPase component 59% 404.8
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 59% 98% 404.8 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-mannitol catabolism mtlK med ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 56% 99% 399.8 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 57% 100% 393.7 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 56% 99% 374.8 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-maltose catabolism thuK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 56% 99% 374.8 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 56% 99% 374.8 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 56% 99% 374.8 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 55% 95% 372.5 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 54% 98% 363.6 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
trehalose catabolism thuK med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 54% 98% 363.6 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 53% 97% 354 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 53% 97% 354 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 53% 97% 354 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 53% 97% 354 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 53% 97% 354 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 53% 97% 354 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 51% 95% 343.6 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 51% 95% 343.6 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
trehalose catabolism malK med MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 48% 100% 333.6 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 51% 100% 331.3 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 47% 93% 326.2 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 46% 93% 320.1 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 58% 407.9

Sequence Analysis Tools

View WP_094573760.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MATLSFHNATKSYGNVDVIKGVDLNIEDREFVVFVGPSGSGKSTLLRMIAGLEEITGGDL
TIDGQQCNDVPPDERGLAMVFQTYALYPHMNVRDNMGFALKLAKIPKSERDRKVEEVAKT
LQLDQLLDRKPGQLSGGQRQRVAIGRAMVREPKIFLFDEPLSNLDAALRVQMRIELARLH
DRLNATMIYVTHDQVEAMTLADKIVVLRDGKVEQLGSPLELYHHPVNQFVAGFIGSPTMN
FIDVKVKTVDANGVTVALANGNSVTVPVKSNGVDIGASLVLGVRPEHLHPASDGTLDGEI
MVVERLGGETYLYVQNSAAKDLIVAEAGGGSTARTHEVAKLGFNPADAHLFKSDGLALER
RERHPLLLSEKKTHR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory