GapMind for catabolism of small carbon sources

 

Protein WP_017616632.1 in Nocardiopsis gilva YIM 90087

Annotation: NCBI__GCF_002263495.1:WP_017616632.1

Length: 406 amino acids

Source: GCF_002263495.1 in NCBI

Candidate for 58 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism malK_Aa hi ABC-type maltose transporter (EC 7.5.2.1) (characterized) 56% 92% 384.8 MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] 58% 367.1
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 58% 86% 367.1 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
trehalose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 55% 93% 361.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 57% 86% 357.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 56% 87% 340.1 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
trehalose catabolism malK med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 56% 87% 340.1 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 47% 99% 331.3 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 53% 86% 321.2 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 48% 95% 317.4 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 48% 95% 315.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 47% 90% 315.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 54% 82% 315.1 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 50% 96% 313.2 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-mannitol catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 50% 88% 311.6 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-sorbitol (glucitol) catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 50% 88% 311.6 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 49% 94% 307.8 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 46% 98% 294.3 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 46% 98% 294.3 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 46% 98% 294.3 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 45% 98% 293.9 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 45% 96% 293.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 49% 85% 292.4 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 51% 86% 292 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 51% 86% 289.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 51% 86% 289.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 51% 86% 289.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 51% 86% 289.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 51% 86% 289.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 51% 86% 289.7 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 58% 74% 289.3 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 58% 74% 289.3 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 46% 86% 270 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 41% 89% 249.6 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 82% 231.9 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
glycerol catabolism glpT med ABC transporter for Glycerol, ATPase component 2 (characterized) 41% 76% 195.3 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 40% 85% 192.6 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 80% 214.5 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 77% 199.9 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 77% 199.9 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 77% 199.9 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 77% 199.9 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 34% 99% 166.8 ABC-type maltose transporter (EC 7.5.2.1) 56% 384.8

Sequence Analysis Tools

View WP_017616632.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAKIVLDGVDKVYSGNVKAVDDLNLEINDGEFMVLVGPSGCGKSTALRMIAGLEEITDGD
LHIGDQVVNDLPPKDRDIAMVFQNYALYPHMTVEQNLAFGLKLRKIPKAEIKARVDQAAA
MLGLEAYLKRKPAALSGGQRQRVAMGRAIVREPQAFLMDEPLSNLDAKLRVQMRASLNQL
HERLGVTTVYVTHDQVEAMTLGDRVAVLREGRLQQVDTPKILFDQPVNLFVAGFIGSPAM
NFVVAELQQDGEGAQLKFADHTLPISAAELDARDGLRSYVGRQVILGLRPSDFEDDEISS
HGPAAMTVTADVTEELGTEINVIFTVNAPPVQHEDAAALAADAAGDGPGAESATLPLGAD
KTLFTARVSPRSGVRPGQAVTLSVDVTQLHYFDRESGLAIGHPANR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory