Align phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) (characterized)
to candidate WP_094932730.1 CDO52_RS24225 phosphomannomutase/phosphoglucomutase
Query= BRENDA::Q8PGN7 (450 letters) >NCBI__GCF_002263495.1:WP_094932730.1 Length = 454 Score = 311 bits (797), Expect = 3e-89 Identities = 184/441 (41%), Positives = 249/441 (56%), Gaps = 11/441 (2%) Query: 8 FKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAGLRASG 67 FKAYD+RG VPD L+ D++R IG A A + VV+ +D+R +SP L A + G+ G Sbjct: 8 FKAYDVRGVVPDTLDADISRAIGAAFARVVGGDAVVVAYDMRPSSPELATAFAEGVTGQG 67 Query: 68 RDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDTGLFAI 127 DV+ GL T+ +YF + +L G M TASHNP YNG+K+ + +A PISS+TGL I Sbjct: 68 LDVVFAGLGSTDLLYFASGHL-GLPGAMFTASHNPAQYNGIKMCKAEAAPISSETGLDEI 126 Query: 128 RDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAGLIV-- 185 R PT S R AY HL S VD + ++PLK+VV+AGNG G V Sbjct: 127 RTLAEKGVPPHDGPTGSITERDMLAAYAAHLRSLVDLTDVRPLKVVVDAGNGMGGHTVPA 186 Query: 186 ---DLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDNGADFGIAWDGDF 242 D + LP E V +F E DG FPN NPL P+N V+ GAD G+A+DGD Sbjct: 187 VLGDTVLDPLPLEIVPLFFELDGTFPNHPANPLDPDNIVDLQDKVRATGADIGVAFDGDA 246 Query: 243 DRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCK 302 DRCF D G + + ++A LAK+PG ++H+ + E V E GG PV + Sbjct: 247 DRCFVVDERGEPVPPSAITAMVAVRELAKEPGATIIHNLITSHAVPEIVRENGGEPVRTR 306 Query: 303 SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA 362 GH+FIKE M A++GGE SAH+YFR+F AD+GM+ + + + S L++ + A Sbjct: 307 VGHSFIKETMAQTGAIFGGEHSAHYYFRDFWRADTGMLAAMHVLRFLGSSTGKLSE-ITA 365 Query: 363 RMQKFPCSGEINFKVADAKASVARVMEHYAS-LSPELDYTDGISADF--GQWRFNLRSSN 419 ++ SGEIN +VADA +A V Y +D DG++ G W FNLR+SN Sbjct: 366 EYSRYAASGEINSEVADASGRMAAVEAAYTGRADARIDDLDGLTVALADGSW-FNLRASN 424 Query: 420 TEPLLRLNVETRGDAALLETR 440 TEPLLRLNVE + + R Sbjct: 425 TEPLLRLNVEAPDTETMAKLR 445 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 454 Length adjustment: 33 Effective length of query: 417 Effective length of database: 421 Effective search space: 175557 Effective search space used: 175557 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory