Align glyoxylate reductase (EC 1.1.1.26); glycerate dehydrogenase (EC 1.1.1.29); hydroxypyruvate reductase (EC 1.1.1.81) (characterized)
to candidate WP_017618255.1 CDO52_RS17960 2-hydroxyacid dehydrogenase
Query= BRENDA::Q9C9W5 (386 letters) >NCBI__GCF_002263495.1:WP_017618255.1 Length = 352 Score = 107 bits (267), Expect = 5e-28 Identities = 78/258 (30%), Positives = 123/258 (47%), Gaps = 20/258 (7%) Query: 99 NVDVEAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRGGLYEG-WLPHL 157 NV+VEAA ++G+AV PG TAE L L+AARRI + +R G + G + + Sbjct: 100 NVNVEAATRHGVAVCYAPGRNAAATAEHTLGLILSAARRIPDLHADLRHGRWRGDFYDYD 159 Query: 158 FVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYFDLYQSTRLEKFVTAYGQFLKAN 217 G ++G TVG++G G IG A + L++ + +VT Sbjct: 160 NCGVEIEGATVGLVGYGAIGRRVAAALAALGARVLVH---------DPYVT--------- 201 Query: 218 GEQPVTWKRASSMEEVLREADLISLHPVLDKTTYHLVNKERLAMMKKEAILVNCSRGPVI 277 G+ +++ +L EA ++SLH L T L+ +A M+ A+LVNC+RG ++ Sbjct: 202 GDALAGTATKVALDHLLAEAHIVSLHARLTPETTGLLGPSEIAAMRPGAVLVNCARGGLV 261 Query: 278 DEAALVEHLKENPMFRVGLDVFEEEPFMKPG-LADTKNAIVVPHIASASKWTREGMATLA 336 D A+ + L+ + DV+ EEP L N ++ PH+A AS+ A + Sbjct: 262 DYDAVCDALERGHLHAAAFDVYAEEPVPADSRLLSAPNVVLTPHVAGASRQVAHKAADIV 321 Query: 337 ALNVLGRVKGYPIWHDPN 354 A V + G P+ H N Sbjct: 322 AAEVGRFLTGRPLAHCAN 339 Lambda K H 0.318 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 352 Length adjustment: 30 Effective length of query: 356 Effective length of database: 322 Effective search space: 114632 Effective search space used: 114632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory