Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_095509028.1 BSZ37_RS02510 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_002283365.1:WP_095509028.1 Length = 253 Score = 105 bits (263), Expect = 7e-28 Identities = 82/249 (32%), Positives = 117/249 (46%), Gaps = 15/249 (6%) Query: 14 RVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGV----ADVSDC 69 R L++GA+ GIG IA A + GA+V A D A Q AD+SD Sbjct: 11 RALVTGASRGIGQGIAVALAEAGADVVCASTRRAGTDETAEAVRQRGRRAWQLEADLSDR 70 Query: 70 AQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAV 129 + + A ++ G +D+L+NNAG AV D A+WE + TNL++ F L +AV Sbjct: 71 EAAAALAEAAEAEAGPIDILVNNAGTIRRHPAV-DFPMADWEFVLRTNLDATFV-LCQAV 128 Query: 130 PLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILP 189 I+ +AS+ G Y ASK A+ G+ K+LA E P+ V VNAI P Sbjct: 129 GRGMVERGRGKIVNVASLLSFQGGVTVPAYTASKHAVAGLTKALANEWAPSGVTVNAIAP 188 Query: 190 GVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNI 249 G + + + A S I L++I R D+ A+FLASPA + Sbjct: 189 GYIATDNTQALQDNEARSRQI---------LERIPAGRWGDPADLGGAAVFLASPASDYV 239 Query: 250 SGQAISVDG 258 +G + VDG Sbjct: 240 NGHVLVVDG 248 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 253 Length adjustment: 24 Effective length of query: 239 Effective length of database: 229 Effective search space: 54731 Effective search space used: 54731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory