Protein WP_099018084.1 in Marinicella litoralis KMM 3900
Annotation: NCBI__GCF_002591915.1:WP_099018084.1
Length: 570 amino acids
Source: GCF_002591915.1 in NCBI
Candidate for 34 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-mannose catabolism | TM1749 | med | TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 49% | 83% | 272.7 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-mannose catabolism | TM1750 | med | TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 53% | 77% | 264.6 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-cellobiose catabolism | cbtD | lo | CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) | 33% | 79% | 175.3 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-cellobiose catabolism | cbtF | lo | CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) | 35% | 81% | 170.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-cellobiose catabolism | TM0027 | lo | TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) | 37% | 90% | 155.6 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-proline catabolism | proV | lo | Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) | 36% | 56% | 142.1 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-histidine catabolism | PA5503 | lo | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 34% | 73% | 140.6 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-proline catabolism | opuBA | lo | BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) | 35% | 56% | 140.6 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-cellobiose catabolism | TM0028 | lo | TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) | 31% | 82% | 139.4 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-arabinose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 35% | 63% | 136.7 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-fructose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 35% | 63% | 136.7 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
sucrose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 35% | 63% | 136.7 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-xylose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 35% | 63% | 136.7 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-histidine catabolism | hutV | lo | ABC transporter for L-Histidine, ATPase component (characterized) | 32% | 88% | 129.4 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
putrescine catabolism | potA | lo | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 33% | 60% | 128.3 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 33% | 63% | 124 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 33% | 63% | 124 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 32% | 67% | 124 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-arabinose catabolism | xacJ | lo | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 33% | 60% | 123.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 32% | 68% | 120.6 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 32% | 68% | 120.6 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 31% | 63% | 119.8 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-cellobiose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 59% | 118.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-glucose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 59% | 118.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
lactose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 59% | 118.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-maltose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 59% | 118.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
sucrose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 59% | 118.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
trehalose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 59% | 118.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 32% | 59% | 118.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 33% | 65% | 117.1 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-tryptophan catabolism | ecfA1 | lo | Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) | 33% | 82% | 115.5 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
sucrose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 32% | 65% | 115.2 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
D-maltose catabolism | musK | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 31% | 57% | 109.8 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
L-arabinose catabolism | xylGsa | lo | Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) | 31% | 86% | 100.5 | Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 | 47% | 505.4 |
Sequence Analysis Tools
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MNNNQLLSIEHLSIEFNTHEGVVRAVDDLSFAIKAGQTIGLVGESGSGKSVTALSVLGLI
PQPPGNITSGAINYLGDDLLKMPEKQLRQIRGNDISMVFQEPMTSLNPVFRVGYQISEVL
RLHKNLSKKQAWQKTVELMDWVGIPEPHRRARSYPHELSGGQKQRVMIAMAIACEPKLLI
CDEPTTALDVTIQQQVLELLQQLQKDLSMSMLFITHDLGVIADLADEVVVMYRSKKVEQA
ITAKIFTEAHHPYSKGLLACRPKLHDNPQRLLTVSDFMNAAGEELTPTLAQQQPQIKADK
NHHEVLLRVNELKTHFPIKGGFFGRVQSHVKAVDGVSFTVKKGETLGLVGESGCGKTTLG
RTLLKLQRATSGSVHYDGIDVFAQSPKDMRRLRSRMQIIFQDPFASLNPRMTIGQAIMEP
LNIHRPEDSKVLRWERVAELIKQVDLNPDQLNRFPHEFSGGQRQRISIARALAVDPEFIV
CDESVSALDVSVQAQVLNLLLDLQAQRDLTYIFISHDLSVVNFIADRVGVMNQGKIVELN
TAEEIYRNPQNPYTQKLLDAIPKGVPRATK
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory