Protein WP_099020204.1 in Marinicella litoralis KMM 3900
Annotation: NCBI__GCF_002591915.1:WP_099020204.1
Length: 228 amino acids
Source: GCF_002591915.1 in NCBI
Candidate for 28 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 34% | 56% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
putrescine catabolism | potA | lo | Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) | 34% | 56% | 132.5 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
L-asparagine catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 32% | 89% | 130.2 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
L-aspartate catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 32% | 89% | 130.2 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
L-glutamate catabolism | gltL | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 32% | 89% | 130.2 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-mannitol catabolism | mtlK | lo | ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) | 36% | 57% | 129.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
L-histidine catabolism | BPHYT_RS24015 | lo | ABC transporter related (characterized, see rationale) | 35% | 86% | 129.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 34% | 63% | 127.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
trehalose catabolism | thuK | lo | Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized) | 31% | 54% | 126.3 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 34% | 64% | 125.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 34% | 64% | 125.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 32% | 53% | 123.2 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 32% | 55% | 122.5 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 60% | 122.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 60% | 122.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 60% | 122.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 60% | 122.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 60% | 122.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 60% | 122.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
L-fucose catabolism | SM_b21106 | lo | ABC transporter for L-Fucose, ATPase component (characterized) | 33% | 54% | 119.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-maltose catabolism | malK | lo | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 32% | 55% | 115.5 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 34% | 51% | 114 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-mannose catabolism | TM1749 | lo | TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 33% | 66% | 108.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-cellobiose catabolism | SMc04256 | lo | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 32% | 56% | 107.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-cellobiose catabolism | TM0027 | lo | TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) | 31% | 88% | 105.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
D-maltose catabolism | malK_Sm | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 30% | 53% | 104 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
trehalose catabolism | malK | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 30% | 53% | 104 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
L-proline catabolism | HSERO_RS00900 | lo | ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) | 30% | 89% | 86.3 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 53% | 237.7 |
Sequence Analysis Tools
View WP_099020204.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSDSVVLKCENLSKFFTDGQRKIQIFEGLDFQVKAGESVAIMGASGSGKSTLLHLLGGLD
TANAGDINIQGQQLSKLSGRQRGLLRNQHLGFVYQFHHLLPEFSALENVMMPLLIGKTAK
AAAKQQATEILQQVGLSDRLTHRPAQLSGGERQRAAIARAMVTSPACILADEPTGNLDEK
TASSVMDLLINLKEQLNTSLVLVTHDQKVADKMQHQYLLQQGALIKLS
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory