Align Short-chain dehydrogenase (characterized, see rationale)
to candidate WP_099018991.1 CCS90_RS07845 glucose 1-dehydrogenase
Query= uniprot:A0A2E7P8M8 (258 letters) >NCBI__GCF_002591915.1:WP_099018991.1 Length = 250 Score = 108 bits (269), Expect = 1e-28 Identities = 80/248 (32%), Positives = 123/248 (49%), Gaps = 9/248 (3%) Query: 6 QDKVVIVTGGASGIGGAISLQLAAEGAIPVVFARSEPDPQFWARLTGLQP-RAALFQLEL 64 ++KVV++TG + GIG AI+ Q AA+GA +V +RS+ A +A Sbjct: 5 ENKVVLITGASRGIGEAIAHQFAAQGAQVIVSSRSQEGIDAVANAIKQNGGKAGAITCHN 64 Query: 65 QDEARCGEAVAETVRRFGRLDGLVNNAGVNDSVG--LDAGRNEFVASLERNLIHYYVMAH 122 D+A + +T+ ++G+LD ++NNA N G LD G ++E N+ Y+ M+ Sbjct: 65 GDKASRDGLIKQTIEQYGQLDVMINNAAANPYFGNVLDMGFEAIKKTIEVNIEGYFHMSQ 124 Query: 123 YCVPHL-KATRGAILNVSSKTALTGQGNTSGYCASKGAQLSLTREWAAALRDDGVRVNAL 181 + K G I+N SS N S Y ASK A +S+T +A G+RVNA+ Sbjct: 125 LAGQQMRKQGAGVIINTSSVNGRVAGFNQSLYSASKAAIISMTESFAKECAQFGIRVNAV 184 Query: 182 IPAEVMTPLYEKWIATFENPQEKLDAITSKIPLGKRFTTSEEMADMAVFLLSGRSSHTTG 241 +P T K+ + + L I +IPLG R EE+A +FL S + + TG Sbjct: 185 LPGLTDT----KFASALTQNEAMLKMILPQIPLG-RIAQPEEIAPAYLFLASDAAKYITG 239 Query: 242 QWVFVDGG 249 + +DGG Sbjct: 240 VSLPIDGG 247 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 250 Length adjustment: 24 Effective length of query: 234 Effective length of database: 226 Effective search space: 52884 Effective search space used: 52884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory