Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate WP_099020147.1 CCS90_RS13710 3-oxoacyl-ACP reductase FabG
Query= SwissProt::Q8P3K4 (300 letters) >NCBI__GCF_002591915.1:WP_099020147.1 Length = 245 Score = 111 bits (277), Expect = 2e-29 Identities = 76/248 (30%), Positives = 128/248 (51%), Gaps = 16/248 (6%) Query: 57 LQGKRCLITAAGAGIGRESALACARAGAHVIATDIDAAALQALA---AESDAITTQLLDV 113 L G+ L+T A GIG+ A A+AGA V+ T Q+++ AE + +LDV Sbjct: 3 LSGQTVLVTGASRGIGKAIATTLAQAGAVVVGTATSEGGAQSISNYLAEFNG-HGYVLDV 61 Query: 114 TDAAAITALVAAH----GPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTCKA 169 + +I L+ + G +L N AG + ++ W + + N+ ++Y KA Sbjct: 62 ANQESIDVLLQSMKEGVGLPTILVNNAGITNDKLLMRMGIDDWDQVINTNLSSIYRMSKA 121 Query: 170 VLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNAI 229 + GM++ G IIN+ SV + G P + Y KA +IG SK++A + ++G+ N I Sbjct: 122 CIRGMMKAKTGRIINIGSVIGDM-GNPGQSNYAAAKAGIIGFSKSLAKEVGSRGITVNVI 180 Query: 230 CPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFTTG 289 PG I+T + ++A S ++ P+ RLG ++IA V++LASD ++ TG Sbjct: 181 APGYIQTDMTDEL-------DEAQKDSLMEQVPLKRLGSTQDIANAVLFLASDSGAYITG 233 Query: 290 QTHIIDGG 297 +T ++GG Sbjct: 234 ETLHVNGG 241 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 245 Length adjustment: 25 Effective length of query: 275 Effective length of database: 220 Effective search space: 60500 Effective search space used: 60500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory