Align mannose-1-phosphate guanylyltransferase (EC 2.7.7.13) (characterized)
to candidate WP_099018892.1 CCS90_RS07270 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
Query= BRENDA::P07874 (481 letters) >NCBI__GCF_002591915.1:WP_099018892.1 Length = 481 Score = 387 bits (995), Expect = e-112 Identities = 200/473 (42%), Positives = 289/473 (61%), Gaps = 7/473 (1%) Query: 1 MIPVILSGGSGSRLWPLSRKQYPKQFLALTGDDTLFQQTIKRLAFDGMQAPLLVCNKEHR 60 +IPVILSGG+G+RLWP+SRK YPK F+ L TL + T R + ++ Sbjct: 3 IIPVILSGGAGTRLWPVSRKAYPKPFMQLADGKTLAELTFDRALDIATEGEVVTVTSRDY 62 Query: 61 FIVQEQLEAQN----LASQAILLEPFGRNTAPAVAIAAMKLV-AEGRDELLLILPADHVI 115 + + + + +N + Q+ LLEP GRNTAPA+A+AA+++ A G D +++++P+DH+I Sbjct: 63 YFLCKDIYKKNKKCDIDKQSFLLEPIGRNTAPAIALAALQVQKAHGDDAIMIVMPSDHLI 122 Query: 116 EDQRAFQQALALATNAAEKGEMVLFGIPASRPETGYGYIRASADAQLPEGVSRVQSFVEK 175 ++ F + + A A KG + FGI + PETGYGYI+A +L + S ++ FVEK Sbjct: 123 KNIETFNKTVYQAAELAAKGYLTTFGIFPTAPETGYGYIKAGQ--RLNDHASVIEQFVEK 180 Query: 176 PDEARAREFVAAGGYYWNSGMFLFRASRYLEELKKHDADIYDTCLLALERSQHDGDLVNI 235 P A +V++G Y WNSGMF F+ +E ++K ++ + + + V Sbjct: 181 PSLEVAEAYVSSGEYSWNSGMFAFQVGSLIEAMQKTANEVMTQAKACFDSTDTNNSQVEF 240 Query: 236 DAATFECCPDNSIDYAVMEKTSRACVVPLSAGWNDVGSWSSIWDVHAKDANGNVTKGDVL 295 + F PD SIDYAVMEK + VV WND+GSW+++ ++ D GN +G + Sbjct: 241 ELKQFMQLPDISIDYAVMEKADKRAVVDSRFDWNDIGSWNAMANLSDSDEAGNRIEGKAI 300 Query: 296 VHDSHNCLVHGNGKLVSVIGLEDIVVVETKDAMMIAHKDRVQDVKHVVKDLDAQGRSETQ 355 DS NC + +LV+V+G+ D++VV+T DA++IAHKD+ Q VK VV+ L A+ Sbjct: 301 TVDSKNCYIRAGDRLVAVVGVNDLMVVDTTDAVLIAHKDKSQGVKDVVQFLKAKDHEAAV 360 Query: 356 NHCEVYRPWGSYDSVDMGGRFQVKHITVKPGARLSLQMHHHRAEHWIVVSGTAQVTCDDK 415 H V+RPWGSY ++ +VK + VKPG LSLQ+HH R+EHW VVSGTA+V D Sbjct: 361 FHKTVHRPWGSYTILEDEDDCKVKRLIVKPGQVLSLQLHHKRSEHWTVVSGTAKVRVGDD 420 Query: 416 TFLLTENQSTYIPIASVHRLANPGKIPLEIIEVQSGSYLGEDDIERLEDVYGR 468 FLL N+S YIP+ ++HRL NP + +IEVQ GSY GEDDIER ED+YGR Sbjct: 421 EFLLEANKSVYIPVETLHRLENPTDTDIALIEVQCGSYFGEDDIERFEDIYGR 473 Lambda K H 0.319 0.134 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 577 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 481 Length of database: 481 Length adjustment: 34 Effective length of query: 447 Effective length of database: 447 Effective search space: 199809 Effective search space used: 199809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory