Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate WP_099020000.1 CCS90_RS12965 alpha-ketoacid dehydrogenase subunit beta
Query= uniprot:G1UHX5 (328 letters) >NCBI__GCF_002591915.1:WP_099020000.1 Length = 326 Score = 288 bits (736), Expect = 2e-82 Identities = 151/319 (47%), Positives = 202/319 (63%), Gaps = 1/319 (0%) Query: 1 MSEITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAE 60 M++ITM +A+ AL L D I+ GED+G GGVFR T GLA ++G++R DTPLAE Sbjct: 1 MAKITMVEAVTMALAHELEHDKDVIVLGEDVGINGGVFRATSGLAQKYGEDRVLDTPLAE 60 Query: 61 SAILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYG 120 + I G VGMA G RPV E QF F YP E ++ H A++RNRTRG + PL IR PYG Sbjct: 61 AMIAGMTVGMATQGMRPVAEAQFLGFIYPMVEHIICHAARMRNRTRGRLTCPLVIRAPYG 120 Query: 121 GGIGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLY-WR 179 GGI EHHS+S+E + PG+ VV ++ + AY LL +I +PDPV+FLEPKR+Y Sbjct: 121 GGIHAPEHHSESTEALFAHMPGIRVVVASSPSRAYGLLLAAIRNPDPVLFLEPKRVYHLN 180 Query: 180 KEALGLPVDTGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLM 239 KE + + PL + R GT TL+ +G + LEAA+ AE G EVID+ T+ Sbjct: 181 KEEVEDDGEEYPLDMCFVIREGTDVTLVTWGAMMKETLEAADKLAEQGISAEVIDVATIS 240 Query: 240 PLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYP 299 P+D T+ SV +TGR V++ EA +EIAA + ++ Y+L APV+RVTG+DV P Sbjct: 241 PIDMDTIHESVAKTGRCVIIQEAAKHCSVSSEIAANLADQGLYNLNAPVKRVTGYDVIMP 300 Query: 300 PPLLERHYLPGVDRILDAV 318 LE+ Y+P VDRIL+ V Sbjct: 301 LFKLEKKYMPSVDRILEKV 319 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 326 Length adjustment: 28 Effective length of query: 300 Effective length of database: 298 Effective search space: 89400 Effective search space used: 89400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory