Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_099019330.1 CCS90_RS09695 acyl-CoA dehydrogenase
Query= BRENDA::B0EVL5 (395 letters) >NCBI__GCF_002591915.1:WP_099019330.1 Length = 590 Score = 83.2 bits (204), Expect = 2e-20 Identities = 79/258 (30%), Positives = 112/258 (43%), Gaps = 45/258 (17%) Query: 54 RAIFNEMGELGLLGATIPEQYGGSGMNYVCYGLIAREVERVDSGYRSMMSVQSSLVMVPI 113 + ++ E E G +YGG G++Y ++ G+ + + + I Sbjct: 80 KKLYKEFCESGWAALDGDPEYGGQGLSYWLQLILGELNTYYCPGWSNYPGLTHGAREL-I 138 Query: 114 NEFGSEETKQKYLPKLATGEWVGCFGLTEPNHGSDPGSMVTRAR-KVDGGYSLSGAKMWI 172 FGS+ KQK+LPKL TGEW G LTEP+ G+D G + T A+ DG Y ++G K++I Sbjct: 139 AHFGSDVLKQKFLPKLTTGEWSGTMCLTEPHCGTDLGLVNTSAKPNEDGSYDITGTKIFI 198 Query: 173 TNS--PIAD--VFVVWAK-DDAGDIRGFVLEKGWKGLS---------------------- 205 T+ + D + +V A+ DA KG KG+S Sbjct: 199 TSGEHDLTDNIIHLVLARLPDA--------PKGTKGISLFLVPKILLNADLELDQRNTLG 250 Query: 206 APAIHGKVGLRASITGEIVMDEV---FCPEENAFPTVRGLKGPFTCLNSARYGIAWGALG 262 A +I K+GL S T + D E N GLK FT +N AR L Sbjct: 251 AASIEHKMGLNGSATCVMNFDAAKGFLIGEGN-----DGLKIMFTMMNGARLNTGIQGLS 305 Query: 263 AAEACYETARQYTMDRKQ 280 A +A YE A Y DR Q Sbjct: 306 ATQASYENALAYAKDRLQ 323 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 530 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 590 Length adjustment: 34 Effective length of query: 361 Effective length of database: 556 Effective search space: 200716 Effective search space used: 200716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory