Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_099617823.1 CLH62_RS08955 SDR family oxidoreductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_002744735.1:WP_099617823.1 Length = 251 Score = 112 bits (281), Expect = 6e-30 Identities = 81/250 (32%), Positives = 126/250 (50%), Gaps = 16/250 (6%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESAL--AVFRDKYPGTVATR--ADVS 67 G +++GG+ GIG +A A G V +C SE L + + G R DV Sbjct: 7 GKNAVVTGGSKGIGRSIALALAAEGVNVAICARSEGPLDDTLTEIEALGVKGYREVCDVG 66 Query: 68 DAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHH 127 D +++A + LG +D+LV N G + A W A I ++L + R Sbjct: 67 DKHRLDAFLDNVKGTLGSVDILVCNVSALGAGNNLKA-----WDANITLDLLSTVRAVDK 121 Query: 128 AVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALL 187 +P +KE+ G+++ ++S++G + PYAATK A++ KSLA + G IRVN++ Sbjct: 122 VLPWMKEAGSGNIIILSSISG-IEVGTSQPYAATKAALISYAKSLAVDHGPDGIRVNSIA 180 Query: 188 PGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARN 247 PG ++ P G + +AE+ G ++ L +I R E+VA +A+FL S AA Sbjct: 181 PGSIKFP---GGVWDKAEKAG---SDRYHNTLKRIPWGRFGRPEEVANVAVFLASNAASW 234 Query: 248 VTGQAISVDG 257 VTG I VDG Sbjct: 235 VTGACIPVDG 244 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 251 Length adjustment: 24 Effective length of query: 238 Effective length of database: 227 Effective search space: 54026 Effective search space used: 54026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory