Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_099618067.1 CLH62_RS10280 SDR family oxidoreductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_002744735.1:WP_099618067.1 Length = 266 Score = 115 bits (287), Expect = 1e-30 Identities = 80/246 (32%), Positives = 121/246 (49%), Gaps = 12/246 (4%) Query: 18 SGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYP-GTVATR--ADVSDAAQIEA 74 +G +GIG A GA V + D S++ L ++ P GT R DV+D AQ+ A Sbjct: 14 AGSGSGIGRATALRLAREGASVILADTSDAGLVETENQLPEGTDCLRRLVDVADEAQVAA 73 Query: 75 VFKVQREHLGGLDVLVNNAGIAGPTGGIDAISD---AEWQATININLTAQYRFAHHAVPM 131 + G +DVL N AGIA G ++ AEW +++NL H P Sbjct: 74 LVNETMATFGQIDVLCNIAGIASTGKGHPPVTGNDRAEWDQVLSVNLVGTMLLIKHVAPH 133 Query: 132 LKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGIV 191 ++ G +++ ASVAG A Y+A+K ++ L + A +LG ++RVNA+ PG+V Sbjct: 134 MQARKLGAIVNTASVAGIRSGAGGNAYSASKAGVINLTMTAACDLGSDNVRVNAVCPGLV 193 Query: 192 EGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVTGQ 251 E G+ RA + E + + L+R E++AA LFL S A +TGQ Sbjct: 194 E----TGMTRAVFDYARA--NEKAHKLGARCELRRYGNPEEIAAAILFLASDDASYITGQ 247 Query: 252 AISVDG 257 ++ VDG Sbjct: 248 SLPVDG 253 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 266 Length adjustment: 25 Effective length of query: 237 Effective length of database: 241 Effective search space: 57117 Effective search space used: 57117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory