Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_066195582.1 CWS20_RS10610 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_002835735.1:WP_066195582.1 Length = 271 Score = 233 bits (593), Expect = 4e-66 Identities = 113/252 (44%), Positives = 176/252 (69%), Gaps = 1/252 (0%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 L TE+L ++YG ++ D+++ +P GKITA+IGPNGCGKST+L +R++ +SG+VFL Sbjct: 4 LFTEDLRIAYGDQVIVKDLNMLIPDGKITAIIGPNGCGKSTVLKTVARIIQAKSGSVFLD 63 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 I+ S++ +A+++++LPQ PEG+T+ ELVSYGR P+ G+L+ +D + A Sbjct: 64 GKQISKESTKSIAQKMAILPQSPDAPEGLTIGELVSYGRFPYQRGMGKLNDKDRNVIEWA 123 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMG 182 + T I+ R + LSGGQRQR ++AM LAQ T ++LLDEPTTYLD+ HQ++++ L+ Sbjct: 124 LKATGISDFKDREVDALSGGQRQRVWIAMALAQETDIILLDEPTTYLDLCHQLEVLELLK 183 Query: 183 ELRT-QGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEI 241 EL + +T+V V+HDLN A+R+ D L+ M G ++ G +EVMT +LR VF+++AEI Sbjct: 184 ELNVLENRTIVMVIHDLNHAARFADHLIAMRAGSIVKSGNGKEVMTKPVLREVFNIDAEI 243 Query: 242 HPEPVSGRPMCL 253 +P + +P+CL Sbjct: 244 GIDPRTKKPICL 255 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 271 Length adjustment: 25 Effective length of query: 230 Effective length of database: 246 Effective search space: 56580 Effective search space used: 56580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory