Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_101288409.1 CXZ10_RS06880 methionine ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_002844595.1:WP_101288409.1 Length = 368 Score = 122 bits (305), Expect = 1e-32 Identities = 73/241 (30%), Positives = 128/241 (53%), Gaps = 14/241 (5%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 ++ + V + FG +AL D++L+VR + IIG +GAGKSTL+ CL G PD+G + Sbjct: 29 VVALSGVSRSFGPTRALDDLSLTVRRGEILGIIGRSGAGKSTLIRCLNGLERPDSGRIEI 88 Query: 63 DGKSVLGRAPYEINQMG--ISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVS 120 +G++++G + E+ + I +FQ + +V++N+ +P E A Sbjct: 89 EGRNIVGLSESELQPIRRKIGMIFQHFNLMSAKTVVDNVALPLKIAGWSKAERRA----- 143 Query: 121 GQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMA 180 +A +L+ + ++DK +++S G K+R+ I LS P LLL DE T+ + Sbjct: 144 -------RALELLDLVGLSDKAGAYPSALSGGQKQRVGIARALSARPALLLSDEATSALD 196 Query: 181 RADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNP 240 T + LLK I + +T+ +I H+M VV ++ DR+ VL G + E + ++ +P Sbjct: 197 PETTRAILTLLKDINRKLGVTVVLITHEMEVVRTIGDRVAVLEAGRIVEEGEVWHVFSDP 256 Query: 241 K 241 K Sbjct: 257 K 257 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 368 Length adjustment: 27 Effective length of query: 224 Effective length of database: 341 Effective search space: 76384 Effective search space used: 76384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory