Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_101287199.1 CXZ10_RS01560 2-hydroxyacid dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >NCBI__GCF_002844595.1:WP_101287199.1 Length = 338 Score = 347 bits (890), Expect = e-100 Identities = 177/322 (54%), Positives = 231/322 (71%), Gaps = 1/322 (0%) Query: 1 MRILFFSSQAYDSESFQASNHRHGFELHFQQAHLQADTAVLAQGFEVVCAFVNDDLSRPV 60 MR+ FS++ YD + HG EL F + L TA LA+GF VCAFVND L V Sbjct: 1 MRVAIFSTKPYDRTFLSRAAASHGHELTFFEPRLDRTTARLAEGFPAVCAFVNDTLDAEV 60 Query: 61 LERLAAGGTRLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRL 120 + L++GGTR+VALR+AG+N+V L AAE G+ V+ VPAYSPHAVAE +VGL+L L+RR+ Sbjct: 61 IATLSSGGTRIVALRAAGFNNVALDAAEEKGVTVLRVPAYSPHAVAEFSVGLLLALDRRI 120 Query: 121 HRAYNRTREGDFSLHGLTGFDLHGKRVGVIGTGQIGETFARIMA-GFGCELLAYDPYPNP 179 HRA+ R RE +F+L GL G DLHG+ VG++GTG+IG AR GFGCE++A+D Y Sbjct: 121 HRAWARVRENNFALEGLLGHDLHGRTVGIVGTGRIGALVARAYRLGFGCEVVAHDRYEVD 180 Query: 180 RIQALGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVN 239 ++A+G Y+ D L+ SDI+SLHCPLT +T +LID +A K G +LINT RGAL+N Sbjct: 181 DLKAIGVTYVDRDELIERSDIISLHCPLTPETHYLIDEAAIARAKQGFLLINTSRGALIN 240 Query: 240 AAALIEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFL 299 A A+I LKSG++G + LDVYE+EAD+FFED S + +QDDV RLL+FPNV++T HQAF Sbjct: 241 AEAVIGGLKSGRIGGVALDVYEQEADLFFEDLSSEIIQDDVFQRLLTFPNVLITGHQAFF 300 Query: 300 TREALAAIADTTLDNIAAWQDG 321 T EAL AIA+TT+ NIA + G Sbjct: 301 TEEALLAIAETTMGNIADEEAG 322 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 338 Length adjustment: 28 Effective length of query: 301 Effective length of database: 310 Effective search space: 93310 Effective search space used: 93310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory