Align N-acetylglucosamine transporter nagP (characterized)
to candidate WP_101442931.1 BD749_RS03265 sugar MFS transporter
Query= reanno::ANA3:7025962 (432 letters) >NCBI__GCF_002846395.1:WP_101442931.1 Length = 474 Score = 194 bits (492), Expect = 6e-54 Identities = 147/461 (31%), Positives = 234/461 (50%), Gaps = 63/461 (13%) Query: 14 PMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLI---LFSFYIAVTF----TAL 66 P+ +V LFF+ GF T +N L+P L+++ L +QA LI F Y V+F ++ Sbjct: 29 PLIVVTLLFFMWGFITCMNDILIPKLQEVFTLQLWQAMLIQTAFFGAYFIVSFFYFMLSI 88 Query: 67 PSAWVIRKVGYKNGMALGMGIMMLAGLLFIPAAKTQIFGLFLCAQLVMGTGQTLLQTAVN 126 I+K+GYKNG+ +G+ + L +LF PAA +G FL A ++ +G T+LQ N Sbjct: 89 TKGDPIQKIGYKNGIIIGLIVAALGCVLFYPAAVFHSYGFFLMALFILASGITVLQITAN 148 Query: 127 PYVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQIDEMAN 186 PYV LGP E++++R+++ LN IAP++ LI D + +ID A+ Sbjct: 149 PYVAILGPPETSSSRMNLSQALNSFGTTIAPIIGGYLIFDQ--------VASAEID-TAD 199 Query: 187 SLVFPYLGMAIFIGVLALAVKKSPLPELSNEDEVAEHTDKGQIKAALSHPNLAFGVIALF 246 S+ PYLG+A + +LAL +K + LP L ++ + G + A+ HP+L G+I +F Sbjct: 200 SVKLPYLGLAALLLLLALLIKVAKLPRLEGSGKI----ETGAV--AVKHPHLVLGIICIF 253 Query: 247 VYVAVEVIAGDTIGTF--------ALSLGVEHY------GVMTS--YTMVCMVLGYTLGI 290 +YV EV G + + +HY G M + V + G Sbjct: 254 MYVGGEVSIGSALINYIKLPQITGLTESEAKHYLAFYWGGAMIGRFFGAVALSTLKRSGK 313 Query: 291 ILIPRFISQPTALMISA---------ILGLL-LTLAIL----FGDNN-----SYAIANAL 331 ++ I+ T L + A ILGL+ L + +L F N + A+ L Sbjct: 314 FMVIALIALVTFLTVYALYDLNEALIILGLIALNVVVLLLARFIPNRTVGLFAMAVIGLL 373 Query: 332 LVPFGGVALPDTLLF--IAFLGLANAIVWPAVWPLALSGLGKLTSTGSALLIMGIAGGAF 389 L+ GV TL I +GL N+I++P ++ LA+ GLG+ TS GS+LL+M I GGA Sbjct: 374 LI---GVVAEGTLAMWAIIAIGLFNSIMFPTIFDLAIKGLGRHTSQGSSLLVMAIVGGAI 430 Query: 390 GPLFWGLTSSATDMGQQGGYMVMLPCYLFILFYAVKGHKMR 430 P GL + T Q +++ + CY +I++Y G+K++ Sbjct: 431 VPPLQGLFADLTG-DLQLSFIIPMICYAYIVYYGFVGYKVK 470 Lambda K H 0.327 0.141 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 432 Length of database: 474 Length adjustment: 33 Effective length of query: 399 Effective length of database: 441 Effective search space: 175959 Effective search space used: 175959 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory