Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_101442772.1 BD749_RS02395 ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_002846395.1:WP_101442772.1 Length = 231 Score = 156 bits (394), Expect = 5e-43 Identities = 86/229 (37%), Positives = 135/229 (58%), Gaps = 5/229 (2%) Query: 1 MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGG 60 ++E +++ KTY R + L+ + +QAG ++G SG+GK+TLL L L+ S G Sbjct: 4 ILEINNLKKTYNSGDRHLTVLEGINITLQAGDTCAIVGPSGSGKTTLLGLCAGLDRASSG 63 Query: 61 RILVEGEDVTALDAEGLRRFR-QRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVD 119 +++ G + L + + R Q VG IFQ+F L+ + T +N+ +PL L G V Sbjct: 64 SVVLNGVQLDNLSEDARAQVRNQYVGFIFQNFQLIPTLTALENVMVPLELRG---ERNVQ 120 Query: 120 ARVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTAS 179 + ELLARVGL++ YP QLSGG++QRV +ARA + RP+IL DE T LD +T Sbjct: 121 GQAMELLARVGLAERHDHYPTQLSGGEQQRVSLARAFSNRPTILFADEPTGNLDEETGEK 180 Query: 180 VLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVAD 228 V +LL E+NRE T+VL+TH++++ + ++ + GG +V A+ Sbjct: 181 VEKLLFELNREAGTTLVLVTHDLELAEKT-QRIIRIKGGHVVSDTKTAE 228 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 231 Length adjustment: 25 Effective length of query: 310 Effective length of database: 206 Effective search space: 63860 Effective search space used: 63860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory